Monopterus albus (swamp eel): 109970760 Help Entry 109970760         CDS       T05607                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism malb  Monopterus albus (swamp eel) Pathway malb04010   MAPK signaling pathway malb04012   ErbB signaling pathway malb04068   FoxO signaling pathway malb04137   Mitophagy - animal malb04140   Autophagy - animal malb04150   mTOR signaling pathway malb04210   Apoptosis malb04218   Cellular senescence malb04370   VEGF signaling pathway malb04371   Apelin signaling pathway malb04540   Gap junction malb04625   C-type lectin receptor signaling pathway malb04810   Regulation of actin cytoskeleton malb04910   Insulin signaling pathway malb04912   GnRH signaling pathway malb04914   Progesterone-mediated oocyte maturation malb04916   Melanogenesis Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109970760 (kras)    04012 ErbB signaling pathway     109970760 (kras)    04370 VEGF signaling pathway     109970760 (kras)    04371 Apelin signaling pathway     109970760 (kras)    04068 FoxO signaling pathway     109970760 (kras)    04150 mTOR signaling pathway     109970760 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109970760 (kras)    04137 Mitophagy - animal     109970760 (kras)   09143 Cell growth and death    04210 Apoptosis     109970760 (kras)    04218 Cellular senescence     109970760 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     109970760 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109970760 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109970760 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     109970760 (kras)    04912 GnRH signaling pathway     109970760 (kras)    04914 Progesterone-mediated oocyte maturation     109970760 (kras)    04916 Melanogenesis     109970760 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:malb04131]     109970760 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:malb04031]     109970760 (kras) Membrane trafficking [BR:malb04131]  Endocytosis   Macropinocytosis    Ras GTPases     109970760 (kras) GTP-binding proteins [BR:malb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109970760 (kras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  109970760 NCBI-ProteinID:  XP_020474202 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRLYRLNKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaactggtggtggtgggagctggtggcgttggcaagagcgcacttact attcagctcatccagaatcactttgtggatgaatatgaccccactattgaggactcctac agaaagcaggtagtaattgatggagagacttgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaataccaagtcctttgaggacattcatcactatagagaacagatt aagagggtgaaggactctgaggatgtccccatggtgttggtggggaataagtgtgacctc ccgtcccggacagtggacaccaagcaggctcaggacttggcacgcagctacggcattccc tttattgagacctcagccaaaaccagacagagagtggaagatgccttttacacactggta cgggagatcaggctgtaccggctcaataagctcagcaaggaagaaaagactcctcgttgt gtcaagcttaaaaaatgtgttgtgatgtga

DBGET integrated database retrieval system