KEGG   Mesorhizobium australicum: Mesau_01261Help
Entry
Mesau_01261       CDS       T02417                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mam  Mesorhizobium australicum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesau_01261
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Mesau_01261
Enzymes [BR:mam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mesau_01261
Peptidoglycan biosynthesis and degradation proteins [BR:mam01011]
 Precursor biosynthesis
  Racemase
   Mesau_01261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1313740..1314879
Genome map
AA seq 379 aa AA seqDB search
MYDAPKRSLPEEADAPSEAAAGAILTIDLGAIRENYRRLKARLGGVRCAGVVKADSYGLG
ASQVASTLMKEGCDIFFVALLAEGIALRKAIGAGPEIYVLNGLPPGSEGEAVASGLCAVI
NSGAQLRAWRAAAHRVGQRLPAAIQVDSGMSRLGMAPPEVEAMAGDTAAFDGIAIRYVVS
HLACADEPHHPANEQQRRAFERLRAMLPGAPASLANSSGIFLGPSYHYDLARPGAALYGI
NPTPAEPNPMLPVVRLQAKVAQTRSVEKGTGIGYGHTYHAEGPLSLATISFGYADGWLRR
SASAAWFEGARLPFLGRVSMDSIILDISALPPGRLREGDLVELLGPSQSVDDAAGHAGTI
GYEILASFGTRFHRRYVGG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcccccaaaagatcactgcccgaggaagccgacgccccgagcgaggctgct
gccggggctatcctcaccatcgatcttggcgcgatccgtgaaaattaccggcgactgaag
gcgcggctgggcggcgtgcgctgcgcgggcgtggtcaaggccgacagctacggtctgggt
gcgagccaagtggcatcgacgctgatgaaagaaggctgcgacatcttcttcgtcgctctg
ctggccgaaggaatcgcgctccgcaaggcgatcggggcaggacccgagatctatgtgctg
aacggtctgccgccaggctccgagggggaagcggtcgcgtctggtctctgcgcggtcatc
aacagtggcgcacagttgagagcctggcgcgcggcggcacatcgcgttggccaaagactt
ccggccgcgatccaggtcgacagcggcatgtcgcgacttggcatggcgccgcccgaagtc
gaggccatggccggcgacaccgccgcgttcgatggcatcgccatcaggtatgtagtgagc
catctggcctgcgccgacgagccgcaccatcccgccaacgaacagcagcggcgggccttc
gagcggttgcgtgccatgctgcccggggcacccgcctcgctcgccaattcctccggcatc
tttctgggaccgtcctaccattatgatctcgcccgccctggcgccgcgctctatggcatc
aatccgacgcctgccgaacccaacccgatgctgcccgtggtgcggctgcaggccaaggtg
gcgcagacgcgcagcgtcgaaaagggcaccggcatcggctatggccacacctaccatgcg
gaagggccgctcagcctggcgacgatctcgttcggctacgcggatggctggctgcgccgg
tccgcgtcggccgcctggttcgagggggcgcgcctgcccttcctcggacgcgtatcgatg
gattcgatcattctcgacatctcggccttgccgcccggcaggctccgcgaaggggatctc
gtcgaactgctcggcccttcacagagcgtcgacgatgccgccggccatgccggcaccatc
ggctacgaaatcctggccagctttgggacgcggtttcatcggcgctatgtcggcggctga

DBGET integrated database retrieval system