KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2684Help
Entry
MAP4_2684         CDS       T02662                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP4_2684
  Energy metabolism
   00680 Methane metabolism
    MAP4_2684
Enzymes [BR:mao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MAP4_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2980180..2982987)
Genome map
AA seq 935 aa AA seqDB search
MVEASEGTLEPIGAVQRTLVGREATEPMRADIRLLGAILGDTVREQNGQQVFELVERARV
ESFRVRRSEIDRAELARMFAGIDIHQAIPVIRAFSHFALLANVAEDIHRERRRAIHVAAG
EPPQDSSLAATYAKLDRAQLDSAMVAEALRGAVVSPVITAHPTETRRRTVFVTQHRITEL
MRLHAEGHTETDDGRNIELELRRQVLTLWQTALIRLSRLQITDEIEVGLRYYAAAFFKVI
PQVNAEVRNALRARWPGADLLDEPIVAPGSWIGGDRDGNPNVTADVVRRATGDAAYTALA
HYLAELTACEQELSMSARLVAVTPELAALAEDCAEKARADEPYRRALRVIRGRLTATAAE
ILDRRPQHELDLGLPPYATPAELRADLDTVDASLRAHGSALLADDRLALLREGVRVFGFH
LCGLDMRQNSDVHEEVVAELLAWAGVHPDYRSLPEDERVELLAAELGTRRPLVGDRAELS
ELADKELGVVRAAAHAIRRYGPAAVPNYVISMCRSVSDVLEAAILLKEAGLIDASGPEPY
CPVGISPLLETIEDLHNGAAILHAMLELPLYRALVAARGQSQEVMLGYSDSNKDGGYLAS
SWAVYRAELALVEVARKIGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGAVNGSLRLTEQ
GEVIAAKYAEPQVAQRNLESLVAATLESTLLDVEGLGDTAEPAYAVLDEVAVLAQRAYAE
LVHETPGFVDYFMASTPVSEIGSLNIGSRPTSRKPTESIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFEQWIAAGPQSRAERVDILHDLYRRWPFFRSVLSNLAQVLAKSDLGLAAQYAE
LVDDAALRRRVFGKIADEHRRTIAMHKLITGQDNLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGDDDELVQRGILLTMNGLASALRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggcatccgagggcacgctggaaccgatcggcgccgtccagcgcaccctggtg
gggcgcgaggccaccgagccgatgcgggccgacattcggctgctcggcgccatcctgggc
gacacggtgcgcgagcagaacggccagcaggtgttcgagctcgtcgaacgcgcccgggtg
gaatcgttccgggtgcggcgctccgagatcgaccgggccgagctggcccggatgttcgcg
ggcatcgacatccaccaggccatcccggtcatccgcgccttcagccacttcgcgctgctg
gccaacgtcgccgaggacatccaccgggagcgccgccgggcgatccacgtcgccgccggc
gaaccgccgcaggacagcagcctggccgccacctacgccaaactcgatcgcgcacaactg
gattcggccatggtggccgaggcgctgcggggcgcggtggtgtccccggtgatcaccgcc
caccccactgagacccggcggcgcaccgtcttcgtcacccagcaccggatcaccgagctg
atgcggctgcacgccgaagggcacaccgaaaccgacgacggccgcaacatcgagctggag
ctgcgccgccaggtcctcacgctgtggcagaccgcgctgatccggctgtcccgcctgcag
atcaccgacgagatcgaggtggggctgcgctactacgccgccgccttcttcaaggtcatc
ccgcaggtcaacgccgaggtccgcaacgcgctgcgggcccgctggcccggcgccgacctg
ctcgacgagccgatcgtggcacccggctcctggatcggcggcgaccgcgacggcaacccc
aacgtgacggccgacgtggtgcgccgggccaccggcgacgccgcctacaccgcgctggcg
cactacctggccgagctgaccgcctgcgagcaggagctgtcgatgtcggcgcgcctggtc
gcggtcacccccgagctggccgcgctggccgaggactgcgccgagaaggcccgcgccgac
gagccgtaccggcgggcgctgcgggtgatccgcggccggctcaccgccaccgccgccgag
atcctggaccgccgaccgcaacacgagctggacctgggtttgccgccgtacgccacgccg
gccgaactgcgggccgacctcgacaccgtcgacgcgtcgttgcgcgcgcacggcagcgcg
ctgctggccgacgaccgcctggccctgctgcgagaaggcgtgcgggtcttcgggtttcac
ctgtgtggcctggacatgcggcagaactccgacgtgcacgaggaagtggtggccgagctg
ctggcctgggcgggcgtgcacccggactaccggtcgctgcccgaggacgagcgggtggag
ctgctggcggccgagctgggcacccgccggccgctggtcggggaccgcgcggaactgtcc
gagctggccgacaaggagctgggtgtggtgcgcgcggcggcgcacgccatccggcggtac
ggcccggccgccgtgcccaactacgtcatctcgatgtgccgctcggtctccgatgtgctc
gaggccgcgatcctgctcaaagaggcggggctgatcgacgcgtcgggccccgaaccctat
tgcccggtgggcatctcaccgctgctcgagaccatcgaggacctgcacaacggcgcggcg
atcctgcacgcgatgctcgagctcccgctgtaccgggcgttggtggccgcccgcggacag
agccaggaggtgatgctgggctactccgactccaacaaggacggcgggtacctggcgtcg
agctgggcggtgtaccgcgccgagctggcgctggtcgaggtggcccgcaaaatcggaatc
cggttgcggctcttccacggtcgcggcggcaccgtcgggcgcggcggcggaccgagctac
gaagcgatcctggcgcagccccccggcgcggtgaacggctcgctgcggctcaccgagcag
ggcgaggtgatcgccgccaaatacgccgaaccccaagtggcgcaacgcaatctggaaagc
ctggtggccgccacgctggagtcgacgctgctcgacgtcgagggcctgggcgacaccgcc
gaacccgcgtatgccgtgctcgacgaggtggcagtgctggcgcagcgcgcctacgccgaa
ttggtgcacgagacaccgggtttcgtggactacttcatggcctccaccccggtcagcgag
atcggctcgctgaacatcggcagccggcccacctcacgcaagcccaccgagtccatcgcg
gatttgcgcgccattccctgggtgctggcctggagtcagtcccgggtgatgctgcccggt
tggtacggcaccggttcggcgttcgagcagtggatcgcggccggcccgcagagccgggcc
gagcgggtcgacatcctgcacgacctgtaccgtcgctggccgttcttccgcagcgtgctg
tcgaacctggcccaggtgctggccaaaagtgacctgggcctggccgcgcagtacgccgag
ctggtcgacgacgcggcactgcggcggcgggtgttcggcaagatcgccgacgagcaccgc
cgcaccatcgccatgcacaagctgatcaccggccaggacaacctgctcgccgacaacccc
gcgctggcgcgttcggtgttcaaccgcttcccctacctcgagccgctcaaccacctgcag
gtggagctgctgcgccgctaccgcagcggcgacgacgacgaactggtgcagcgcggcatc
ctgctgacgatgaacggactggccagcgcgctgcgaaacagcggctga

DBGET integrated database retrieval system