KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3529Help
Entry
MAP4_3529         CDS       T02662                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3841539..3842648)
Genome map
AA seq 369 aa AA seqDB search
MDLPVMPPVSPMLAKSVGAIPPAASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPE
LVAAVRAELPQRCVIDGEIVIATDHGLDFEALQQRVHPAESRVRMLAEATPASFIAFDLL
ALGDEDYTGRPFRERRAALLEAVGGPGPSIHVTPATTDLDTARRWFDEFEGAGLDGVVAK
PLDITYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFTELQPLVTDFEDHPWNWAAHQAGERTPRKNEFSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFRLDDIVPGLGASRADH
KPGKQIGAP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcctgtcatgccgccggtgtcgccgatgctggcgaagtcggtcggcgcgatt
cccccggccgcgtcgtatgagcccaagtgggacggcttccggtcgatctgtttccgcgac
ggcgacgaggtcgagttgggcagccgcaacgagcggccgatgacgcgctacttccccgaa
ttggtggcggcggtgcgggcggagctgccgcagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcaacaacgcgtccatccggccgag
tcgcgggtgcggatgctggccgaggccacgccggcgtcgttcatcgccttcgacctgctg
gcgctgggcgacgaggactacaccggccggccgttccgcgagcggcgcgcggcgctgctg
gaggcggtgggcggtccggggccctcgatccatgtcacgccggcgaccaccgatctggac
accgcgcggcggtggttcgacgaattcgagggcgccgggctcgacggtgtggtcgccaag
ccgttggacatcacgtatcagccggacaagcgggtgatgttcaagatcaaacacgagcgg
acggccgactgtgtggtggccggttatcgggtgcacaagtccggggcggacgcgatcggc
tcgttgttgctggggctgtatcaggatgacggccagctcgcgtcggtcggcgtgatcggc
gccttcccgatggccgagcggcggcggctgttcaccgaattacagccgctggtcaccgat
ttcgaggaccacccgtggaactgggccgcgcaccaggccggcgagcgcacgccccgcaag
aacgagttctcgcgctggaacgccggcaaggacctctcgttcgtcccgctgcggcccgag
cgggtggtcgaggtccgctatgaccacatggagggccggcgattccgtcataccgcgcag
ttcaatcgatggcggccggaccgcgacccacgctcctgcacctacgaacagctcgagcag
ccggtgacgtttcgcctggacgacatcgtgccgggcctcggcgcgagccgcgcagatcac
aagcccggcaagcagattggggctccatag

DBGET integrated database retrieval system