KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3686Help
Entry
MAP4_3686         CDS       T02662                                 

Definition
(GenBank) superoxide dismutase SodA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Brite
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MAP4_3686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4015503..4016126
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGVNDALAKLEEARANEDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGL
QGSGWAVLGYDTVGSRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQKRYAAATSKAQGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgacctggactgggactatgcagcgttggaaccgcacatc
tcggggcagatcaacgagatccaccacaccaagcaccacgccacctacgtcaaaggcgtg
aacgacgctcttgccaagctcgaagaggcccgcgccaacgaggaccacgctgcgatcttc
ctgaacgaaaagaacctcgccttccacctgggcggccacgtcaaccactcgatctggtgg
aagaacctgtcgccggacggcggtgacaagcccaccggcgagctggccgccgcgatcgac
gacgcgttcggctccttcgacaagttccgggcgcaattcagcgccgccgccaacggcctg
cagggctccggctgggcggtgctgggttatgacaccgtgggcagccggttgctgaccttc
cagctctacgaccagcaggccaacgtcccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtcaaggcggattacgtcaaggcg
ttctggaacgtggtcaactgggcggacgtgcagaagcggtacgccgccgccacttccaag
gcccaaggcctgatcttcggctga

DBGET integrated database retrieval system