KEGG   Microcystis aeruginosa: MAE_38820Help
Entry
MAE_38820         CDS       T00647                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mar  Microcystis aeruginosa
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAE_38820 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MAE_38820 (ppc)
   00680 Methane metabolism
    MAE_38820 (ppc)
Enzymes [BR:mar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MAE_38820 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(3555953..3559009)
Genome map
AA seq 1018 aa AA seqDB search
MSVLVSSTETEQDIFSTSNLFLQQRLKLIEDLWKEVLVSECGQELVDLLELLRHLCSEEG
QVTDDSPEATIAKMIEDLELGEAIKVTRAFALYFQLINIIEQHYEQRDQQLLRRTVIGEE
NESPKADPTQKSLLATIVGADWLEKTLNESDHSGPKSGLFHWLFPYLKQVNVPPQEIQRL
LDQLDIRLVFTAHPTEIVRHTIRIKQRRISGILEKLDQAEEIFRSMGLTNSREAQTVTKQ
LKEEIRFWWRTDELHQFKPTVVDEVDYALHYFDEVLFDSLPQLTLRLQQSLQSSFPRLQA
PKNNFCRFGSWVGGDRDGNPSVTPEVTWKTCCYQRNLVIKKYLDAIRDLTSILSASLHWC
HVLPELLDSLDRDKQQMPEIYSQLAIRYRQEPYRLKLAFIQKRLENTRDRNDRLNDPEER
QLLTKLNETNIYRSGSEFLAELQLLKRSLFQTGLSCQELDRLIAQVEIFGFVLTQLDFRQ
ESTRHAECIEEIAQYLGVLPKPYGKLTESEKIAWLVAELKTRRPLIPREMPFSERTCETI
ETLRVLRSLQGEFGLEICQTYIISMTNEASDVLEVLLLAQEAGLYDPATSRSSLRIVPLF
ETVDDLKHAPGIMQTLFELPLYRATLAGGYDHLAALNGEDVTPEPAILEPSNLQEIMVGY
SDSNKDSGFLSSNWEIHKAQKALQKTAKQYGVNLRLFHGRGGSVGRGGGPAYAAILAQPR
GTINGRIKITEQGEVLASKYSLPELALYNLETAVTAVIQASLLGSGFDDLEPWNRIMEEL
ATRSRQTYRSLIYEEPDFLDFFLSVTPIPEISLLQISSRPARRKSGQQDLSTLRAIPWVF
SWTQTRFLLPAWYGLGTALQMFLDDSPSRNLELLRHFYHKWPFFQMVISKADMTLSKVDL
QMAYHYVSELSKQEDRERFQRLFERIKEEYNRTSEIVLQITGEKHLLDNDPNLQRSVQLR
NGSIVPLGFLQVSLLKRLRQYNSQAQSGVIHFRYSKEELLRGALMTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccttgtctcctcgaccgaaaccgaacaggatattttcagcacttccaacctg
tttctgcagcaaagactgaaattaatcgaagatttatggaaagaagtcttagtctccgaa
tgtggtcaagaattagtcgatttactggaattactgcgccatctctgttctgaggaagga
caagtgaccgatgatagtccagaagcaacgatcgccaaaatgatcgaagacttggaacta
ggggaagcgatcaaagttacccgcgcttttgccctctatttccagttaataaatataatc
gaacaacactacgaacaaagggatcagcaactactgcgacggacggtgatcggggaagaa
aacgaaagtcccaaggctgacccaacgcaaaaaagccttttagccaccattgtcggggcc
gattggctagaaaaaaccctgaacgagtccgatcactccggcccaaaatcgggactattt
cactggttatttccctatctcaaacaggttaacgtccctccccaagaaattcagcgtctt
ctcgatcagttagatattcgtctggttttcacggctcaccccacggaaattgtccgtcat
accattcgcattaaacagcgccgtatctcaggcattctcgaaaaacttgaccaagcagaa
gaaatctttcgcagtatggggttaactaactccagagaagcacaaacagtcaccaaacag
ttaaaagaagaaatacgtttttggtggcgaacagatgaactacaccaatttaaacccacc
gtcgtcgatgaagtggattatgccctgcactacttcgatgaagttctctttgattcccta
ccccagttaaccctgcgtctgcagcaaagcctacaatcctcctttccccgtttacaagcg
ccgaaaaataacttctgtcgcttcggttcttgggtcgggggagatcgggatggcaatccc
tccgttacccccgaagtcacctggaaaacctgctgttatcagcgcaatctcgttattaaa
aaatatctcgatgctattcgcgacctgaccagtattttaagtgcctccctgcactggtgt
cacgtcttgccggagttgctggactccctggacagagataaacagcaaatgcccgaaatc
tatagccagttagcaattcgctaccgtcaggaaccctatcgcctcaaattggcctttatt
caaaaacgtctggaaaatacgcgtgatcgcaatgatcgcctcaatgacccggaagaacga
caattattaactaaactcaacgaaaccaacatctatcgctccggttccgagtttttagcc
gaattacagctattaaagcgcagtctctttcaaaccggtctttcttgtcaagaactcgat
cgactgatcgcccaagtagagatttttggctttgtcctgactcagttagattttcggcaa
gaatccacccgtcacgccgaatgtatcgaagaaatcgctcaatatctcggagttttaccg
aaaccctatggcaaattaaccgaatcagaaaaaatcgcctggttagtggcggaattaaaa
acccgtcggcccctaattccccgggaaatgcccttttcggaaagaacctgcgaaaccatt
gaaaccctgcgagttttaagaagtctgcaaggggaatttggtctggaaatctgccaaacc
tacattatcagcatgaccaacgaggccagcgatgtgctagaagtgctgttattagcccaa
gaagccggtttatacgaccccgccactagccgcagttccctgcgcatcgttcccctcttt
gaaaccgtcgatgacctcaaacacgcccccggcatcatgcagactttgtttgaattgccc
ctctatcgggcaaccctagctggcggttacgaccatttagcggctttaaacggggaggac
gtgaccccggaaccggccatcttggaaccgagtaatttacaggagattatggtgggttac
tccgatagtaacaaggattctggctttttgagcagtaattgggaaattcataaggcccag
aaggctttacaaaaaaccgctaaacaatacggcgtgaatctacgtctttttcatggccgg
ggcggttccgtcggtcggggtggtggaccggcctacgccgctatcctcgcccaaccccgg
ggaacgattaacggtcgcattaaaatcaccgaacaaggcgaggttttagcctcgaaatac
tctttaccagaattggccttgtataacctcgaaacggccgtaacggcagtcatacaggca
agtttactgggcagtggttttgatgatctcgaaccctggaatcgcatcatggaggagtta
gccacccgttcacggcaaacctatcgcagtttgatttatgaagaaccggactttttagac
ttcttcctgtccgtaactcccattcctgaaattagtcttttacagattagttcccgacca
gcgcgccggaaaagtggtcaacaggatttaagtaccctgcgggcaattccctgggtattt
agttggacccaaacccgttttcttttaccggcttggtatggtttagggacagctttacag
atgtttctcgatgattctcctagcagaaatttggaattgttacgccatttttatcacaag
tggcctttcttccagatggtgatttctaaggcagacatgactctatcgaaggtggaccta
cagatggcctatcactacgtcagtgaactttctaaacaggaagatcgagaacgttttcaa
cgtctgtttgaaaggatcaaagaggaatataatcgcactagcgagattgttctccagatc
accggcgagaaacatttattggataatgatccgaatttacagcgctcggtgcagttacgc
aacggttcgatcgttcccctcggtttcctacaggtgtctctcctcaagcgtttacgtcaa
tacaacagtcaagctcaatccggtgtgattcatttccgctattctaaagaggagttatta
aggggtgctttaatgacgattaatggtattgccgcagggatgagaaataccggttga

DBGET integrated database retrieval system