KEGG   Micromonospora aurantiaca: Micau_0880Help
Entry
Micau_0880        CDS       T01296                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mau  Micromonospora aurantiaca
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Micau_0880
  Energy metabolism
   00680 Methane metabolism
    Micau_0880
Enzymes [BR:mau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Micau_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(876368..879154)
Genome map
AA seq 928 aa AA seqDB search
MTDQHDHDGPDAALRADIRRLGTLLGQTLARQEGRPLLDLVEEIRAQVRSDVPAAAQRLA
GLDVTTGTKLARAFSTYFHLANITEQVHRARDLRRRRATHGGWLDQAAKMIAERGVPAEE
IAAAARRLAVRPVFTAHPTEAARRSILSKLRAVADELDTETANAILYGASDEGPANRRLA
ELLDLMWQTDELRLDRPDPTDEARNAIYYLRDLYAEAAPQVLDDLADTLRTLGVETSPTS
RPLSFGTWIGGDRDGNPFVTPVVTREVLRIQHEHGIAATEKAMDELITEVSVSRRLRAVS
LDLSASLAKDLDALPEVAPRFRRVNAEEPYRLKARCVKAKLANTRERLRADTPHVPGRDY
RGSSELIADLELLRASLARNSGQLTAVGRLASAIRTVSAFGLHLATMDIREHAEKHHEVL
AQLYEAVGEVSDYPALSRLERTKLLADELTGRRPLSTQDSPLTESARKTFDVFAAIREAQ
DRFGPEVIESYIISMTLGVDDVLAAVVLAREAGLVDVHSGRARIGIVPLLETPAELNAGG
ELLDELLSLPAYRALVAARGDVQEVMLGYSDSNKEAGITTSQWSIHRAQRSLRDVAARHG
VHLRLFHGRGGTVGRGGGPTHDAILAQPYGTLDGAIKVTEQGEVISDKYTLPALARENLE
LTVAAVLQATLLHTAPRQPAEMLERWDAAMDVVSESAFRSYRSLVEDPDLPAYFWASTPT
ELLGALNIGSRPAKRPNTGAGLSGLRAIPWVFGWTQTRQIVPGWFGVGSGLAAARAAGLA
DVLAEMNRNWHFFRTFLSNVEMMLTKTDLTIARRYVETLVPKKLHPIFDKIEQEYELTKQ
EVLAVTAAPALLDNSPVLQRTLAVRDTYLEPLHHLQVALLRQYRESGAAGRAVVTAPGGR
RAPNDGTALERALLTTVNGIAAGMRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccagcacgaccacgacggccccgacgccgctctccgggccgacatccgccgc
ctcggcacgctgctcgggcagaccctcgcccggcaggagggccgcccgctgctcgacctg
gtcgaggagatccgcgcccaggtccgctccgacgtaccggccgcggcccagcgcctcgcc
gggctcgacgtcaccaccggcacgaagctggcccgcgccttctccacctacttccacctg
gcgaacatcaccgagcaggtgcaccgcgcccgggacctgcgccgccgccgggcgacccac
ggcggctggctggaccaggcggccaagatgatcgccgagcgcggcgtaccggccgaggag
atcgccgccgcggcccgtcggctggccgtacgaccggtcttcaccgcccaccccaccgag
gcggcccgccggtccatcctgtccaagctgcgcgccgtcgccgacgagctggacaccgag
accgcgaacgcgatcctgtacggcgccagcgacgagggcccggcgaaccgccgcctggcc
gaactgctcgatctcatgtggcagaccgacgaactgcggctggaccggccggacccgacc
gacgaggcgcgcaacgcgatctactacctgcgcgacctgtacgccgaggccgcgccccag
gtcctcgacgacctcgccgacacgctgcgcacgctcggcgtggagacgtcgccgacgtcc
cgcccgctgagcttcggcacctggatcggcggtgaccgcgacggcaacccgttcgtcacg
ccggtggtcacccgcgaggtgctgcgcatccagcacgagcacggcatcgccgccaccgag
aaggcgatggacgagctgatcaccgaggtcagcgtgtcccggcggctgcgtgcggtgtcg
ctcgacctgtccgccagcctcgccaaggacctggacgcgctgcccgaggtggcgccccgg
ttccgccgggtcaacgcggaggagccgtaccggctcaaggcgcggtgtgtgaaggcgaag
ctcgccaacacccgggagcggctgcgtgccgacaccccgcacgtgccggggcgggactac
cggggctcgtccgagctgatcgccgacctggaactgctgcgcgcgtcgctggcccgcaac
tccggccagctcaccgccgtcgggcggctggcctcggccatccgtacggtgtccgcgttc
ggcctgcacctggccaccatggacatccgggagcacgcggagaagcaccacgaggtgctg
gcccagctctacgaggcggtcggcgaggtctccgactacccggcactgtcccggctggag
cgcaccaagctgctcgccgacgagctgaccggccggcggccgctctccacccaggacagc
ccgctcaccgagtcggcccgcaagacgttcgacgtgttcgccgcgatccgcgaggcgcag
gaccggttcggccccgaggtcatcgagtcgtacatcatctcgatgacgctcggcgtcgac
gacgtgctggccgccgtggtgctggcccgcgaggccggcctggtggacgtgcactccggg
cgggcccgcatcggcatcgtgccgctgctggagaccccggccgaactgaacgccggtggc
gagctgctggacgagctgctgtcgctgcccgcgtaccgggcgctcgtggcggcccggggc
gacgtgcaggaggtgatgctcggctactccgactccaacaaggaggcgggcatcaccacc
agccagtggtccatccaccgggcgcagcgctcgctgcgggacgtggccgcgcggcacggc
gtgcacctgcggttgttccacggccgcggcggcaccgtcggccgtggtggcggccccacc
cacgacgcgatcctggctcagccgtacggcacgctcgacggcgcgatcaaggtgaccgag
cagggcgaggtcatctccgacaagtacacgctgccggcgctggcccgggagaacctcgaa
ctgacggtggcggcggtgctccaggccacgctgctgcacaccgcgccccggcagccggcc
gagatgctggagcgctgggacgcggcgatggacgtggtgtccgagtccgcgttccggtcg
taccggtcgctggtcgaggacccggacctgcccgcgtacttctgggcctccaccccgacc
gagctgctgggcgcgctgaacatcggctcccggccggcgaagcgcccgaacaccggcgcc
ggcctgtccggcctgcgcgccatcccgtgggtgttcggctggacgcagacccggcagatc
gtgccgggctggttcggcgtgggttccggtctggccgccgcgcgggcggccgggctggcc
gacgtgctcgccgagatgaaccggaactggcacttcttccgcacgttcctgtcgaacgtc
gagatgatgctgaccaagaccgacctgaccatcgcccggcggtacgtcgagacgctggtg
ccgaagaagctgcacccgatcttcgacaagatcgagcaggagtacgagctgaccaagcag
gaggtgctcgcggtcaccgccgcaccggcgctgctggacaactcgccggtgctccagcgc
acgctcgccgtgcgggacacctacctggagccgctgcaccacctccaggtggcgttgctg
cggcagtaccgcgaatccggcgccgccgggcgtgcggtggtgaccgcgccgggtgggcgg
cgtgccccgaacgacggtacggcgctggagcgggcgctgctgaccaccgtcaacggcatc
gccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system