KEGG   Micromonospora aurantiaca: Micau_2667Help
Entry
Micau_2667        CDS       T01296                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
mau  Micromonospora aurantiaca
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Micau_2667
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Micau_2667
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Micau_2667
Bacterial toxins [BR:mau02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Micau_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3052596..3054350)
Genome map
AA seq 584 aa AA seqDB search
MSPRRAIPRRATVLAAAALTLLSVLPATAAQAAAPAGVTATVGADCTAGRLLLDLDNRSA
TTQTYTVTWPGRTGSPWTRTVAAGGSAELYWTLSPGTPYTLRTTTPTGLDDTTSGIFHCG
TGMSALAGFDCTNGRLQLALENRTTTARDFTVTWPGRTGSPWTRTVAAGGNYLHYWTVGA
GTPYTLRITAPGFDTTLRGTTSCDLAAGNPQLATTTLLTTQTVIRDLNGAGGRYDGTVAS
VRIPGLAVTNNGTVVAVADARVNGSYDLGGGTNNIQIVMIRSTDGGRTFEQPRVIHAPPT
TSEGVGDPSLLVDRATGVVYCFFTYSPRPGISFWSGGSGLNTADDPNSMHLRYITSRDNG
ATWSAPVELNPAVKDPTWRQVFFSSGHGIQTSTGRLIQPIAYRDSAGTSHAANIYSDDHG
VTWRRGGSAGGNINESKAIERGTGAVVQNMRHNSTRSRFYATSADGGATFGTATASALLP
DPLCNADEMSYLRPAEVGANRAPVRTRTALFSNNAHPTARNDLTVRLSTDDGATWPARAL
VKPGGAGYSTMAVLADGTVGNLYEVGNTGGIYFARFSLDWVKGA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccctcgccgcgccataccgcgccgcgcaaccgtcctcgcggcggccgccctcacc
ctgctctccgtactgcccgccaccgccgcccaggccgccgcccccgccggtgtgaccgcc
accgtcggcgccgactgcaccgccggccggctgctgctcgacctcgacaaccgcagcgcc
acgacgcagacctacaccgtcacctggccgggtcgcaccggctcgccgtggacccgcacc
gtcgccgccggtggcagcgccgagctgtactggacgctgtcccccggcacgccgtacacg
ctgcgcaccacgaccccgaccggtctggacgacaccaccagcggcatcttccactgcggc
accggcatgtccgcgctggccggcttcgactgcacgaacggccgcctccagctcgccctg
gagaaccgcaccacgacggcccgggacttcacagtcacctggcccggacgcaccggctcg
ccgtggacccgcaccgtcgccgccggcggcaactacctgcactactggaccgtcggcgcc
ggcaccccgtacacgctgcggatcaccgcgccgggcttcgacaccacgctgcgcggcacc
acctcctgcgacctcgccgccggtaacccgcagctcgccaccaccacgctgctgaccacg
cagacggtgatccgcgacctcaacggagccggtggccggtacgacggcaccgtcgcctcg
gtccgcatccccggcctggccgtcaccaacaacggcaccgtcgtcgccgtggccgacgcg
cgcgtgaacggctcgtacgacctcggcggcggcaccaacaacatccagatcgtgatgatc
cgcagcaccgacggcggccgtaccttcgagcagcctcgcgtcatccacgccccgcccacc
accagcgagggcgtcggcgaccccagcctgctcgtggaccgcgccaccggcgtcgtctac
tgcttcttcacctactccccccggcccggcatcagcttctggtccggcggctccggcctg
aacaccgccgacgacccgaacagcatgcacctgcgttacatcaccagccgggacaacggc
gccacctggagcgcgccggtcgagctgaaccccgcggtcaaggaccccacctggcggcag
gtgttcttctcctccggccacggcatccagaccagcaccggacgcctgatccagccgatc
gcctaccgggactccgccggcaccagccacgccgcgaacatctacagcgacgaccacggc
gtgacctggcgccgcggcggatccgccggcgggaacatcaacgagagcaaggcgatcgag
cgcggcaccggcgcggtggtgcagaacatgcggcacaactcgacccgcagccggttctac
gccacctccgccgacgggggcgcgacgttcggtacggcgacggcgagcgccctgctgccc
gacccgctgtgcaacgccgacgagatgtcctacctgcgcccggccgaggtcggcgcgaac
cgggcgccggtacgcacccgcacggcgctgttcagcaacaacgcgcacccgaccgcgcgc
aacgacctcaccgtacggctgtccaccgacgacggcgcgacctggccggcgcgggcgctg
gtcaagcccggcggcgccggctactcgacgatggcggtcctggccgacggcacggtcggc
aacctgtacgaggtgggcaacaccggcggcatctacttcgcccggttcagcctcgactgg
gtgaagggcgcctga

DBGET integrated database retrieval system