Mesocricetus auratus (golden hamster): 101824687 Help Entry 101824687         CDS       T08306                                  Symbol Mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04010   MAPK signaling pathway maua04014   Ras signaling pathway maua04015   Rap1 signaling pathway maua04072   Phospholipase D signaling pathway maua04137   Mitophagy - animal maua04140   Autophagy - animal maua04218   Cellular senescence maua04371   Apelin signaling pathway maua04625   C-type lectin receptor signaling pathway maua04810   Regulation of actin cytoskeleton maua05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101824687 (Mras)    04014 Ras signaling pathway     101824687 (Mras)    04015 Rap1 signaling pathway     101824687 (Mras)    04371 Apelin signaling pathway     101824687 (Mras)    04072 Phospholipase D signaling pathway     101824687 (Mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101824687 (Mras)    04137 Mitophagy - animal     101824687 (Mras)   09143 Cell growth and death    04218 Cellular senescence     101824687 (Mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101824687 (Mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101824687 (Mras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101824687 (Mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:maua04031]     101824687 (Mras) GTP-binding proteins [BR:maua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101824687 (Mras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N AAA_16 Motif Other DBs NCBI-GeneID:  101824687 NCBI-ProteinID:  XP_005072060 EnsemblRapid:  ENSMAUG00000028546 UniProt:  A0A1U8C485 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITRDQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaacaagcgctgttccgagtgacaacctccccacctataaactggtagtggtagga gatggaggtgtgggcaagagtgccctcaccatccagtttttccagaagatctttgtgcct gactatgaccccaccattgaagactcgtacctgaagcacacggagattgacaatcagtgg gccattctggatgtcctagacacagcagggcaggaggagttcagcgccatgcgggaacag tacatgcgcactggggacggcttcctcatcgtgtactccgtcaccgacaaggccagcttc gagcacgtggaccgcttccaccagctcattctgcgcgtcaaggacagggagtcattccca atgatcctcgtggccaacaaggtggatttgatgcacctgaggaaaatcaccagggatcaa ggaaaagaaatggcgaccaaacacaatatcccgtatatagaaaccagtgctaaggaccca cctctcaatgtggacaaagccttccatgacctcgttagagtaattaggcaacagattccg gagaaaagccagaagaagaaaaagaaaacgaagtggcgaggggaccgggccactggcact cacaaacttcagtgtgtgatcttgtga

DBGET integrated database retrieval system