KEGG   Mycobacterium avium 104: MAV_0182Help
Entry
MAV_0182          CDS       T00433                                 

Definition
(GenBank) [Mn]-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mav  Mycobacterium avium 104
Brite
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MAV_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABK66442
UniProt: A0A0H2ZVN7
LinkDB All DBs
Position
complement(175683..176306)
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGVNDALAKLEEARANEDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGL
QGSGWAVLGYDTLGSRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQKRYAAATSKAQGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgacctggactgggactatgcagcgttggaaccgcacatc
tcggggcagatcaacgagatccaccacaccaagcaccacgccacctacgtcaaaggcgtg
aacgacgctcttgccaagctcgaagaggcccgcgccaacgaggaccacgctgcgatcttc
ctgaacgaaaagaacctcgccttccacctgggcggccacgtcaaccactcgatctggtgg
aagaacctgtcgccggacggcggtgacaagcccaccggtgagctggccgccgcgatcgac
gacgcgttcgggtccttcgacaagttccgagcgcaattcagcgccgccgccaacggcctg
cagggctccggctgggcggtgctgggctatgacaccctgggcagccggttgctgaccttc
cagctctacgaccagcaggccaacgtcccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtcaaggcggactacgtcaaggcg
ttctggaacgtggtcaactgggcggacgtgcagaagcggtacgccgccgccacttccaag
gcccaaggcctgatcttcggctga

DBGET integrated database retrieval system