KEGG   Mycobacterium avium 104: MAV_0360Help
Entry
MAV_0360          CDS       T00433                                 

Definition
(GenBank) DNA ligase
Organism
mav  Mycobacterium avium 104
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(354042..355136)
Genome map
AA seq 364 aa AA seqDB search
MPPVSPMLAKSVGAIPPAASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPELVAAV
RAELPQRCVIDGEIVIATDHGLDFEALQQRIHPAESRVRMLAEATPASFIAFDLLALGDE
DYTGRPFRERRAALLEAVGGPGPSIHVTPATTDLDTARRWFDEFEGAGLDGVVAKPLDIT
YQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFTELQPLVTDFEDHPWNWAAHQAGERTPRKNEFSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFRLGDIVPGLGASRADHKPGKQ
IGAP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgtcgccgatgctggcgaagtcggtcggcgcgattcccccggccgcgtcg
tatgagcccaagtgggacggcttccggtcgatctgtttccgcgacggcgacgaggtcgag
ttgggcagccgcaacgagcggccgatgacgcgctacttccccgaattggtggcggcggtg
cgggcggagctgccgcagcgctgcgtgatcgacggggagatcgtcatcgccaccgaccac
ggcctggacttcgaggcgctgcaacaacgcatccatccggccgagtcgcgggtgcggatg
ctggccgaggccacgccggcgtcgttcatcgccttcgacctgctggcgctgggcgacgag
gactacaccggccggccgttccgcgagcggcgcgcggcgctgctggaggcggtgggcggt
ccggggccctcgatccatgtcacgccggcgaccaccgatctggacaccgcgcggcggtgg
ttcgacgaattcgagggcgccgggctcgacggtgtggtcgccaagccgttggatatcacc
tatcagccggacaagcgggtgatgttcaagatcaaacacgagcggacggccgactgtgtg
gtggccggttatcgggtgcacaagtccggggcggacgcgatcggctcgttgttgctgggg
ctgtatcaggatgacggccagctcgcgtcggtcggcgtgatcggcgccttcccgatggcc
gagcggcggcggctgttcaccgaattacagccgctggtcaccgatttcgaggaccacccg
tggaactgggccgcgcaccaggccggcgagcgcacgccccgcaagaacgagttctcgcgc
tggaacgccggcaaggacctctcgttcgtcccgctgcggcccgagcgggtggtcgaggtc
cgctatgaccacatggagggccggcgattccgtcataccgcgcagttcaatcgatggcgg
ccggaccgcgacccacgctcctgcacctacgaacagctcgagcagccggtgacgttccgc
ctgggcgacatcgtgccgggcctcggcgcgagccgcgcagatcacaagcccggcaagcag
attggggctccatag

DBGET integrated database retrieval system