KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_21770Help
Entry
RC58_21770        CDS       T03787                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
Pathway
mavi00250  Alanine, aspartate and glutamate metabolism
mavi00410  beta-Alanine metabolism
mavi00430  Taurine and hypotaurine metabolism
mavi00650  Butanoate metabolism
mavi01100  Metabolic pathways
mavi01110  Biosynthesis of secondary metabolites
mavi01120  Microbial metabolism in diverse environments
mavi02024  Quorum sensing
Module
mavi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mavi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RC58_21770
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RC58_21770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RC58_21770
   00430 Taurine and hypotaurine metabolism
    RC58_21770
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RC58_21770
Enzymes [BR:mavi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RC58_21770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJK77331
UniProt: A0A202G0M8
LinkDB All DBs
Position
4678682..4680073
Genome map
AA seq 463 aa AA seqDB search
MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKTKDWKKRTPNLVMGSNVQVVWEKFCRYFDVEPRYL
PMEEGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVADICGALDKLALKPASAGGV
DVPVHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLP
DELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTLSGTARWLGEQ
LRVSEHCELISDGSAIPVVAFRLAKNRGYTEFDVSHELRTYGWQVPAYTMPDNATDVSVL
RIVVREGLSADLARALHDDAVSALTSLDKVKPGGHYDAQHFAH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaacatccttcgctgcccgcgcatgccatcgccccggcctacaccggccggctg
ttcaccgcgccggtgcccgctctgcggatgcccgacgaatcgatggatcccgacgccgcc
taccggttcatccacgacgagctgatgctcgacggcagctcccggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccgggcggttgatggccgagacattcgacaag
aacatgatcgacaaggacgaatacccggccaccgcggccatcgagcagcgctgcgtgtgc
atggtcgccgacctgttccacgccgaaggtctgaacgacgccgacccgtacagcgcctgc
ggggtgtccaccatcgggtccagcgaggcggtgatgttgggcgggctggcgatgaagtgg
cggtggcgcgccaagaccaaggactggaagaagcgcaccccgaacctggtgatgggctcc
aacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctacctg
ccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgacgag
gacaccatcggcgtggtggccatcctgggcaccacctacaccggcgagctggaaccggtc
gccgacatctgcggcgcgctggacaagctggccctcaaaccagcatcagccggcggcgtg
gacgtcccggtgcacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcacccc
gagctcaagtgggacttccggctgccccgggtggtgtcgatcaacgtcagcgggcacaag
tacgggctgacctatcccggcgtcggcttcgtggtgtggcgcagcaaggaatacctgccc
gacgagctggtgttccgggtcaactacctgggcggcgacatgccgaccttcacgctgaac
ttctcccgccccggcaaccaggtggtcggccagtactacaacttcctgcggctgggccgc
gagggctacaccaaggtgatgcagacgctgtccggcacggcgcgctggctgggcgagcag
ctgcgggtcagcgagcactgcgagctgatctcggacggctcggcgatcccggtggtcgcc
ttccggctggccaagaaccgcggctacaccgagttcgacgtctcccacgagctgcgcacc
tacggctggcaggtgcccgcctacaccatgcccgacaacgccaccgacgtctcggtgctg
cgcatcgtggtgcgtgaggggctgtcggccgacctggcccgggcgctgcacgacgacgcc
gtctcggcgctgacctcgctggacaaggtcaagccgggcggccactacgacgcccagcac
ttcgcgcactga

DBGET integrated database retrieval system