KEGG   Metarhizium acridum: MAC_00208Help
Entry
MAC_00208         CDS       T03104                                 

Definition
(RefSeq) fatty acid oxygenase, putative
Organism
maw  Metarhizium acridum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1122 aa AA seqDB search
MSPPVEHKSESAANGAQNGTHTNGTQTNGTHTNGHHAREKEVPKKVVQPTETQKSEKKTT
SSIGALMRLRRASRRPLPTEMGDGTYRNILKRPNLMQDLKSFGLGDLKTLRDIIEAKLKR
ETQQDDKTMLMERTIQLVSMMPNKSKRQEILTNSFIDKLWNSLDHPPLLYMGDEYKYRQP
DGSNNNPLMPKLGAAGTPYSRTCKPGPANMGALPDPELIYEAVMARNGFKKNPNNVSSIL
WYWATIVIHDLFWTNSKDPNQNDSSSYLDLSPLYGKSKEDCDSIRTFKDGKLKPDTFADR
RLIGNPPGVCILLIMFNRFHNYVVANLASINEGNRFAKPAAHLEGDALAAAWKKYDEDLF
QTARLVTSGLYINITLVDYVRNIINLNRVDTKWTLDPRQEMGVAVGTAKGAESGVGNVVS
AEFNLCYRWHSCISEMDDKWIQDFYAQILGDNYGEMNLQTLIAAVKRYEMTIPEEPSERT
FGGFTRGPDGRFKDDELVGAICTAIEQPGGAFGAQNVPRIMKPVEMLGIIRGRKWNLCGL
NEFRKHFGLKAYDKFEDINSDPGVADALRNLYQHPDHVELYPGIVAEEGKAPMVPGVGIA
PTYTISRVVLSDAVSLVRGDRHYTTDYHPGHLTQWGFNEANYDLEINHGCVFYKLFIRAF
PNHFKYNSIYAHYPMVTPNENRKILTNLKRAEHFDFGRPEFIAPPIHLASYGAAQHVLTN
QEKYKVAYEEAFRFLVGSSGTKCMLAGDDPAHAEQRKVMHSLLYEDGWKASVKSFYAMIT
ERLLAEKSYKIAGKTQVDVVRDIGNLAHTHFAARMFNLPLKSSENPKGVFSEQELYEALA
ILFICIFLDLDPVKSFPLRQKAKEVTEQLVKVVGMNVKLTKSLGIRGLYTGPAPKSDDLS
RYGVNLIKGLSKAGLGAHDIVCSHVLPIAGAMVPVQAQAFAQAVDWYLSREGQEYLPELQ
RLAVAESSPENDALLLGYAMEGVRLASAFGLFREATETEIIKEDDGREVHVKAGDRVFVS
LASAAREEAYFPEANKVNPRRPIDTYMHYGAGPHGCLGREASHVALVELFRALFRKRGLK
RVPGPLGELKKVPQPGGLYLYMTENWGGVSPFPTSMKISWDE
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctcctgtggaacacaaaagcgagagcgctgccaatggcgcgcaaaatggcacc
cacacgaacggcacccagacaaatggtacacatacaaatggccatcacgctcgagagaag
gaagtacctaagaaagttgtacagcccacagagacccaaaaatcggaaaagaagacgact
tcatccattggggctttgatgcggttgcgtcgtgcttcacgacgccctctccccacggag
atgggagatggcacttatagaaacattctcaagcgaccgaatctgatgcaggatctcaaa
tcatttggattgggtgatctcaaaacacttcgagatattatcgaggcaaagctgaagaga
gagacccagcaagatgacaagacaatgctcatggagcgcactattcaattggtctccatg
atgccgaataaatcgaagcgacaagaaatactcaccaactctttcattgacaagctatgg
aactctctggatcacccaccgttgctgtatatgggtgatgagtacaagtatcgccaacca
gatggatctaacaacaatccgttaatgccgaagcttggggccgctgggactccatattcg
cgcacttgcaagccagggccagccaatatgggagcactacccgatcccgagcttatttat
gaggccgtcatggctaggaatgggtttaagaaaaacccaaacaacgtgtcaagcatttta
tggtattgggcgactattgtaattcacgatttgttctggaccaattcaaaggatcccaat
caaaatgactcctcatcatatcttgacctgtctcctctatatggaaaaagcaaagaggac
tgtgattcaattcgaaccttcaaagatggcaagctgaaaccagatactttcgcagatcga
cgacttattggtaacccacccggagtctgcattctgctcatcatgtttaaccgctttcac
aactacgtggtcgccaacttggcttccattaacgagggtaaccgattcgcaaagcctgca
gcgcatctggaaggcgatgcgcttgcagctgcctggaagaagtacgatgaagacttgttc
cagacggctcgacttgtcacatctggcctatatataaacatcactcttgttgactatgtg
cgcaacatcattaatctcaacagagtcgacacgaagtggacgttggatccgagacaggag
atgggagtcgccgtgggcaccgccaaaggcgcggaaagtggtgttggtaatgtcgtctct
gccgagttcaatctgtgctacagatggcattcgtgcatttctgagatggacgacaagtgg
attcaagacttttatgcgcagattctcggcgacaattatggcgagatgaacctccagacc
ctaattgcagccgtcaagagatatgagatgaccattcctgaggagccctcagagcgcaca
tttggcggatttactcgcgggcccgatggacgcttcaaagatgatgagctcgtcggtgcc
atctgtacagcaattgagcaacccggcggtgcgtttggagctcagaacgtgcctcgaatt
atgaagccagttgagatgctgggcatcatccgaggtcgcaagtggaatctctgtggcctt
aatgaattccgcaagcactttggactgaaggcctatgataagttcgaggacatcaattcg
gatcctggtgttgccgatgctttgagaaacctgtaccagcatccggaccatgttgaactg
taccctggtatcgtggctgaagaaggcaaggctcctatggttccaggcgtaggaattgct
cccacctacaccatctccagagtcgtgctctctgatgccgtctctctggtccgtggcgac
aggcattataccaccgattaccatcccgggcacttgactcagtggggattcaacgaagcc
aactatgatttggagatcaaccatggctgtgtgttctacaagctgttcatccgtgcgttc
cccaaccacttcaagtataactcgatctacgcgcattatcccatggtcacaccaaatgaa
aaccgcaagatcctcacaaatctgaagcgagcggagcactttgactttggtagaccagaa
ttcatcgcgccaccaattcatctggcttcgtatggtgcagcccagcacgtactcaccaac
caggagaagtacaaggttgcgtatgaagaagcgttccgattcctcgtgggatcctctggc
accaaatgcatgctggctggcgatgaccctgctcacgcagagcagcgcaaggtcatgcat
tctctgctatacgaagatggttggaaagcttcagtcaagagtttctatgctatgattacg
gagcgcctgcttgccgagaagtcgtacaagattgctggaaagactcaagttgacgttgta
cgcgatattggcaacctggcccacacgcactttgccgcaagaatgttcaatttgcccttg
aagtcgagtgaaaatcccaagggcgtattctctgagcaagagctttatgaggctctggcg
atcttgtttatctgtatctttttggacctcgaccccgtcaagtcgttccctctccgacag
aaggcaaaagaagtgaccgagcagctggtcaaagttgtagggatgaatgtcaaattaacc
aagtctttgggaattagaggcctctataccggtcctgctcccaagagcgacgacctgtct
aggtatggtgtcaatctcataaaggggctgtccaaggccggccttggtgcgcacgacatt
gtatgcagtcatgttttgccaattgctggtgccatggtgcccgtccaagcccaagcgttc
gcccaagccgtggactggtacctctcccgagagggccaagagtatttaccggaacttcaa
cgcctggctgtcgcagaatcgagcccagaaaacgatgccctcctcctcggctacgccatg
gagggtgtccgtctggctagtgcgtttggtctcttccgtgaagctactgagacagagatt
atcaaagaagacgacgggcgtgaggtccatgtcaaagccggcgaccgcgtctttgtgtca
ctcgcctcagcggcccgcgaagaagcatactttccagaagcgaacaaggtcaacccgcgg
cgtccaatcgatacttatatgcactatggtgctggaccacatggttgcctgggcagggaa
gccagccacgtcgcgctggtggagttgttccgcgcactgtttaggaagaggggattgaag
agagttcctggaccgcttggtgagctgaagaaggttcctcaacccggtgggctctatttg
tacatgacggagaactggggcggtgtatcgccgttccccacgagcatgaagatttcctgg
gatgagtag

DBGET integrated database retrieval system