KEGG   Methanosarcina barkeri Fusaro: Mbar_A0970Help
Entry
Mbar_A0970        CDS       T00271                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Brite
Enzymes [BR:mba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mbar_A0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M DUF587
Motif
Other DBs
NCBI-ProteinID: AAZ69942
JGI: MbarA0970
UniProt: Q46DV0
LinkDB All DBs
Position
1:1181846..1183018
Genome map
AA seq 390 aa AA seqDB search
MSREGNEEIDPQFIARLASFLGFNKERVQHLFEKNYLAQNWGKYEYLFRFDKEISHIERG
TVLYEKDGSFEIIMGFPKIRRAMVLDPTIKKHFNGLEKVAVEEKMNGYNVRIAIAKDEIL
AITRSGYICPYTTQKAKEKLNLKFFDDFPELVLYGEMIGPDNPYVPKDIYDIESVEFYIF
DIREKNSGKPLPIKRKHEILEKYGFFQVKFFKEIPLETAAEEIGKIIRELGEKEHEGVVI
KDPEMVLSPLKYTSSQSNCSDLRHAFKFYNETGRDYMLSRIVREGFQTVEWNEDKDEFEK
RCMQLGKSILGPLSESILSVKNGQRLYEEAKIRVRDLKTAAEFEDYLKRLGIDAIFEEPQ
LVGGEYLVIIKKINKSTNDKTQAIWQGEPW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagaggggaacgaggagatagatcctcaatttatagctagacttgccagtttc
ctgggatttaataaggaaagggttcagcacctttttgagaaaaactatcttgcccagaat
tggggaaaatatgaatatctgttccgtttcgataaggagatctcacatatcgaaagggga
accgtgctttatgagaaagacggttctttcgaaatcattatgggtttcccgaaaatccgg
agagccatggtactggatcccacaattaaaaagcactttaacggccttgaaaaagtggcc
gtggaagaaaaaatgaatgggtataatgtccgcatagcgattgcaaaagacgaaatcctt
gcaattacccggagcgggtatatctgcccttatacgactcaaaaagcaaaagagaagctg
aatctgaaattttttgacgatttccctgaacttgtactttatggagaaatgataggcccg
gacaatccttatgttccaaaagatatctatgacatcgagtcggtagagttttacatcttt
gatattcgggaaaaaaacagcggtaagcctcttccaataaaaaggaagcatgaaattctg
gaaaaatacggctttttccaggtaaagttcttcaaggaaattcccctagaaactgctgct
gaagaaataggaaaaatcatccgggaacttggagaaaaagaacatgaaggagtcgtaata
aaagatccggaaatggttctttctccgttaaaatatacctcttcccagagtaattgctcg
gatctcaggcatgcctttaagttttacaatgagaccggcagagactatatgctttcccgg
attgtcagagaaggttttcaaacagttgaatggaacgaagataaggatgagtttgaaaaa
cgctgcatgcagttagggaagagtatacttggccctcttagtgaatccatcctaagtgta
aaaaacggccagcgtttatatgaggaagcaaagatccgagtaagggatctaaaaactgca
gccgagttcgaagattatcttaaaagactcgggatagatgcaatttttgaagagcctcag
ttagtaggaggagagtatctggtaattataaaaaagattaataaaagtactaatgataaa
actcaagcaatctggcagggcgaaccatggtaa

DBGET integrated database retrieval system