KEGG   Candidatus Methylopumilus turicensis: BN1209_0664Help
Entry
BN1209_0664       CDS       T03844                                 

Definition
(GenBank) putative glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mbac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN1209_0664
Enzymes [BR:mbac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN1209_0664
Transporters [BR:mbac02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN1209_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CEN55707
UniProt: A0A0B7IZ81
LinkDB All DBs
Position
1:complement(628910..629527)
Genome map
AA seq 205 aa AA seqDB search
MIKLYGFPQTRSVRVAWALEEANAEYEYGLVNLRTGEHKQPAFLAINPFGKIPSLVDDGL
VISESAAICTHIAEKFPAAKLIPTDAKSRAAYFQWLFFVVSELEVHLWTAAKHDRFLPED
KRIPDIANTSYWEFEKAAAILSTHLKAQPYLAGDQFSAADIICVSVLHWAHHVKVTLDDT
LLSYMNRVSERPALTRARKREADAT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactttacggttttccacaaacccgctcggtacgcgttgcatgggccttagaa
gaagcaaatgccgagtacgaatacggactcgtcaacttacgcacaggcgaacataaacag
cctgcatttttagcgattaatccctttgggaaaattccaagcttggttgatgatgggcta
gtcatcagcgagtctgcggcaatctgtactcatattgctgaaaaatttcctgcggccaag
ctgattccaactgatgcaaaaagcagagcggcgtattttcaatggctattttttgtagtt
tcagagttagaggtacatttatggacagcggccaaacatgaccgctttctacccgaagat
aaacgcatcccagacatcgcaaacaccagctattgggagtttgaaaaagcggcggctatt
ttaagtacgcatcttaaagcacagccctatttggctggcgaccaatttagcgcagcagat
atcatttgcgtttcggttttacactgggcacatcacgtcaaagtgacgctcgacgacact
ttactgagttatatgaatcgagtttcagaacgtcctgccctcacccgcgccaggaaacgt
gaagccgatgccacttaa

DBGET integrated database retrieval system