KEGG   Marssonina brunnea: MBM_05751Help
Entry
MBM_05751         CDS       T03105                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mbe  Marssonina brunnea
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MBM_05751
Enzymes [BR:mbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MBM_05751
Chromosome [BR:mbe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MBM_05751
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    MBM_05751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 335 aa AA seqDB search
MTSPQHPMEFRHKCHFLYHGRADPKLAHQEEKCHYCQFGKFNSHKLHPISIIFQDNTKLV
IPKDFVFIEKSIPVEGVRFAEDEYLNGCECESDAQCMGSMCDPCLGDVDRVPKGGKPGAY
HVSGDKKGCLRGWMLESRLPIYECHEKCTCSDKCPNRVVGRGRKVALQIFPTSGRGWGVK
STEDIKRGQFVGEYVGEIITPAEANRRRQAATDRKKKDIYLFALDKFQDRESYDQRLRGE
PYEIDGEFKSGPTRFINHSCEPNLRIFAVVTAHANKPFHQLCFFAAKDIPRETELTFDYT
DGVTDARMDVEEAIAQDKELTKCLCGTPSCRGYLW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccgcaacacccaatggaatttcgccacaagtgccacttcctgtaccacggc
agagctgatccaaagctcgctcatcaggaagagaaatgtcattactgccagtttggaaaa
tttaattcgcacaagttgcacccaatctccatcatcttccaagacaacacgaagctggta
atccccaaggatttcgtctttatcgagaagagcattcctgttgaaggggtccgattcgcg
gaggatgaatatttgaacggctgcgagtgtgaaagtgatgcgcaatgtatgggctccatg
tgtgatccatgtctgggggatgtggaccgcgttcccaaaggtggaaagccaggcgcgtac
catgtcagcggcgacaagaaagggtgccttcgcggctggatgctcgaatctcgcttgccc
atctacgagtgccacgagaaatgcacgtgcagcgacaagtgccccaaccgggtggtcgga
cgtggccgcaaagtcgctctacaaatcttcccaacatccggccgcggttggggtgtcaag
tcgaccgaggacatcaagcgcggtcagtttgtcggcgagtacgtgggcgaaatcatcacc
cccgcggaggccaatcgccgccgacaagccgccaccgatcggaagaagaaagacatctac
ctgttcgccctcgacaagttccaggaccgagagagctacgaccagcgcctccgcggcgag
ccgtacgagatcgacggcgagttcaagtccggcccgacgcgtttcatcaaccactcgtgc
gagccgaacctgcgcatcttcgccgtcgtcaccgcgcatgcgaacaagccgttccaccag
ctgtgcttcttcgcggccaaggatatcccccgcgagacggagctgacctttgactacacg
gatggcgttaccgacgctcgtatggatgtggaggaggcgatcgcccaggataaggagctg
accaagtgcttgtgcgggactccgagctgcaggggctacttgtggtga

DBGET integrated database retrieval system