KEGG   Marssonina brunnea: MBM_09189Help
Entry
MBM_09189         CDS       T03105                                 

Definition
(RefSeq) linoleate diol synthase
Organism
mbe  Marssonina brunnea
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450 VKG_Carbox
Motif
Other DBs
NCBI-GeneID: 18765124
NCBI-ProteinID: XP_007297078
UniProt: K1W6L6
LinkDB All DBs
Position
Unknown
AA seq 1103 aa AA seqDB search
MAPNNLKSLLGTIRRKPSKAPDGKTDAEAAPPVAAEKTSIVKDLLTLNPGQAATVAQAFS
TLASGEPMDDKELLLEHGVSMLQTLSLDSGLSKKISDEFIALLYHDLPHPPPTLVGPTVR
YRRHDGGGNSPWDSEMGKAGSPYSRSVPPLKSQGPNLPDPELVFDQLLKRTGPFRPHPSG
LNRLFFSFATVVIHECFQTSRETPWINETSSYADLSTLYGNTIKEQARVRTYENGTIYPD
SIASERIMMMPPGVVAVLLMFSRNHNHIAQNLLTINADGKYKPWDTLSEEEKTAGTKPSP
RQDEDIFQITRNINVGYFASVVLRDYVAAILNTPRANSTWSLDLAAEIKKGGRRVERGTG
NVCSVEFAVLYHWHAALSAADNDWMEWVVNSDIPGLKSMDDLTTEKFMGMLKKRGHALMS
KPAREWTFGGLERGPDGKFDDVQLAEVIKDCINEPAHAFGAHSTPASMKIVEILGQIQAR
DTFNVCTLNEFRKYLNLKPYETFEDWNPEKETARRARLLYGHIDNLELYPGLMAEVTKPA
VPGSGVCPGQTTGRGILNDAVALIRGDRFLSYDFNGSTLTDWGFSKLQAPVPGAYGGIMP
YLLFNALPGAWTGTSPYVLLPFYTPTAAQGILKQNKTILQYSLERPPSGMDVIGIHTHEG
CKKVFEDRENFRVIYQKAIRDCTNGHEFMLGWDDAKRHDERSAILHKVMFEDDFEGKMTK
FFRTNVAQLIKKSSLKYSNSSRRSIDIVRDVTNVTPVLWLAQRFAIPLKTEQYPGGLVSI
PEAFKAFIVTFMYQSFNIIPANEFGLRAGAMQAGDALRPIFEAHLKTQQGFTEGLVDWLA
KGSAFEVGPEADRLYHALNATKLPVGDLVGDCLCIGAGVIGNLTQQASLLIELYLRPGYE
QYKARIAELAHQDDAASDRELLGFVFEGMRHASIVPGLPRVAARDVTVIDGARGPVSIPA
GRTVLVATSSAAMDPAQFPRPEKLDPHRPLGDYILLGHGLHACYGARMVGCSLAATLKEV
FKLKNLRRAKGKRGAFMVAEHELTGLKMRKYLDCNAAESPVPTTLTLEYDEDEGYGVPVV
VGVGANGANGANGNRNGNGSGVW
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaacaacctcaaatcattgctgggcaccattagacgaaagcccagtaaagcc
ccagatggcaagaccgacgccgaagcagctccgcccgtggcagcagaaaagacatccatc
gtcaaagatcttctcacactcaaccctggccaggccgcaactgtggcccaagcattctcc
acgctcgcttctggcgaacccatggacgacaaggagctgctcctcgagcacggcgtcagc
atgcttcaaaccctctccttagacagcggcttgagcaagaagatctcggatgagttcatt
gccttgctttaccacgatcttccccatccgcccccaacgctcgttgggccgacagtcagg
taccgacgacacgacggaggcggcaacagtccgtgggactcggagatggggaaagccggc
tcgccctactcgcgctcggtgcccccgctcaagagccaggggccgaacctccccgatccc
gaactcgtcttcgaccagctcctgaagcggacgggcccgttccgcccgcacccctctggc
ctgaaccgtctgttcttctcctttgcgacggtggtcatccacgagtgtttccagacatcg
cgcgagactccctggatcaatgagacgtctagttatgccgacttgagcaccttatatggg
aacaccatcaaggagcaggcgcgggtgaggacgtacgagaatgggacgatttacccggac
tcgatcgcgtccgagaggatcatgatgatgccgccgggtgtggttgccgttctgctgatg
ttctcacggaaccacaatcacatagcccagaacttgttgacgatcaacgcggatgggaag
tacaagccttgggatactctaagcgaggaggaaaagacggcaggtactaagccatcgccc
agacaagatgaagacatcttccagatcacgcgcaacatcaatgttggctattttgcatcc
gtggtcttgcgggactacgtggccgcgattctcaacactccacgggccaactcgacctgg
tctctggatctcgccgctgaaattaagaaaggtggcagacgggtcgagcgaggaactgga
aacgtctgctcggtcgaattcgctgttctttaccattggcatgccgcactcagtgctgcc
gacaatgactggatggaatgggttgtcaacagtgacatacccggcctcaagtcaatggat
gatctcacaacagagaagttcatggggatgttaaagaagcgaggacatgccttgatgtcc
aagccagccagggaatggacattcggtggcctggaaaggggtccggatggcaagtttgac
gatgttcagctggcggaggtgatcaaagattgtatcaatgagccagctcatgctttcgga
gcgcacagtactccggcctcgatgaagattgtggaaatcttgggtcagatacaagcacgg
gataccttcaatgtttgcacactcaatgaattccgaaaatacctcaatctcaagccgtat
gagaccttcgaggactggaatccggagaaagagaccgcgcggagggctcggttgctgtac
ggccatattgacaacctcgagctgtatcctggcctgatggccgaagtgacaaagcccgcg
gtgcctggtagcggagtctgccctggtcagaccaccgggcgagggatcctgaacgatgcc
gttgccctgattcgaggtgataggttcttaagttacgatttcaacggtagcactctgacc
gactggggcttctctaagctgcaagctcccgtgccaggcgcgtatggggggatcatgcca
tatctgctattcaatgcgcttccaggtgcctggactggcacatcaccatacgtgctgctt
ccgttctacactccgacagccgcccaagggatattgaagcagaacaagaccatcctgcag
tacagcttggagaggccacccagcgggatggacgtcatcggaatccacacccacgagggc
tgcaagaaagtgttcgaggatcgcgagaatttccgcgtcatataccaaaaagccattcgg
gattgcacgaatggccacgagttcatgcttggatgggatgatgcgaagagacacgatgag
cggtcggcaatcctccataaggtcatgttcgaagacgacttcgagggcaaaatgaccaag
tttttccggaccaacgtcgcccagctcatcaagaagtcctcgcttaagtactcaaacagc
tcccggaggtcaatcgacatcgttcgggacgtgaccaatgtcacgcccgtcctctggctg
gcgcaacgatttgccattccgctcaagaccgagcagtatccgggcggcctggtgtcgatc
cccgaggctttcaaagcgttcatcgtaacatttatgtaccagagcttcaacatcatcccg
gcaaacgagttcgggcttcgagccggcgccatgcaagcgggcgatgccctccgaccaatc
ttcgaggcccatctcaagacccagcaaggcttcaccgaaggactcgtcgactggctcgcc
aagggctctgccttcgaggtcggccccgaggcagaccgactctaccacgccctgaacgcc
accaagctccccgtcggcgacctggtcggcgactgcctttgcatcggcgccggcgtcatc
gggaacctcacgcagcaagcctccctcctcatcgagctctacctccgccccggctacgag
caatacaaggcgcggatcgccgagctggcccaccaggacgacgccgcctcggaccgcgag
ctgctcggcttcgtcttcgagggcatgcgccacgccagcatcgtgccgggcctcccccgg
gtcgccgcccgcgacgtgaccgtcattgacggcgcgcgcgggcccgtctccatccccgcc
ggccgcaccgtccttgtcgccacctcctcggccgctatggacccggcccagttcccccgc
ccggagaagctcgacccgcaccgcccgctcggggactacatcctactcggccacggcctg
cacgcctgctacggcgcgcgcatggtagggtgcagcctcgccgcgacgctcaaggaggtc
ttcaagctgaagaatctccggcgcgcgaaggggaagcggggcgcgttcatggtcgccgag
cacgagctcacggggctcaagatgcgcaagtatctggattgcaacgcggctgagagcccc
gtcccgacgacgctcacgctggagtatgacgaggacgaggggtatggtgtcccggtagtg
gtgggggttggggcgaatggggcgaatggagcgaacgggaataggaatgggaatggaagt
ggggtttggtaa

DBGET integrated database retrieval system