KEGG   Marssonina brunnea: MBM_09896Help
Entry
MBM_09896         CDS       T03105                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
mbe  Marssonina brunnea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBM_09896
   00051 Fructose and mannose metabolism
    MBM_09896
   00052 Galactose metabolism
    MBM_09896
   00500 Starch and sucrose metabolism
    MBM_09896
   00520 Amino sugar and nucleotide sugar metabolism
    MBM_09896
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MBM_09896
Enzymes [BR:mbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MBM_09896
Membrane trafficking [BR:mbe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MBM_09896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MVGLGPRFIGSMADVPKDLLQEIKRLEDLFTVPKAKLKEITDHFVNELTKGLTVEGGSIP
MNPTWCMAFPDGHEKGTFLALDMGGTNLRVCEIILTDEQGEFDIIQSKYRMPEELKTGHA
EELWEYIADCLQQFIEHHHGNEKVGSLPLGFTFSYPATQDYVDHGVLQRWTKGFDIDGVE
GENVVPMFEAAIAKRGVPIRLTALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMENC
GSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDVIVDKESPRPGQQAFEKMIAG
LYLGELFRLALVDLHDNKEVHIFEGQNIDKLRKAYTLDSSFLSAIEEDPFENLQETGDLF
ANRLSITATRPELELVRRLAELIGTRAARLSACGVAAISKKKGYDSCHVGADGSVFNKYP
HFKQRGAAALREILDWAPKKSSKDEDPIEILAAEDGSGVGAALIAALTLKRVKEGNMAGI
LHPENFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtaggacttgggcctcgttttataggatccatggccgatgtgccaaaggatcttttg
caggagattaagagactggaagatctgttcaccgttccaaaggccaagctgaaagagatc
accgatcacttcgttaatgagctcaccaaaggtcttaccgttgagggtggaagcatcccc
atgaacccaacatggtgtatggcattcccagatggacacgagaagggcaccttccttgct
ctagatatgggcggaaccaaccttcgtgtttgcgagatcatcttgaccgacgagcaaggt
gaatttgacatcatccagagcaagtaccgcatgcccgaggagctcaaaactgggcacgct
gaagaactgtgggagtacattgcggattgccttcaacaatttattgagcaccaccatgga
aatgagaaagtgggtagccttcctctcgggtttaccttctcttaccccgccacccaagac
tacgtagaccatggagttttgcaacgttggaccaagggcttcgacatcgacggagttgaa
ggagaaaacgtcgtgcccatgttcgaggcggccattgctaagcgaggcgtgcctatcaga
ctcacagctctgatcaacgacaccaccggaaccctgattgcctcggcatacaccgacacc
aagatgaagatcggttgcatcttcggcaccggctgcaacgcggcttacatggaaaattgc
ggctccatccccaagctcgcccacatgaacctgcctcccgacacgccaatggccatcaac
tgcgaatggggtgccttcgataacgagcacaaagtcctcccccgtaccccctacgacgta
atcgtcgacaaggagtccccccgtcccggacaacaagccttcgagaagatgattgccggc
ttgtacctcggcgagctcttccgtcttgctctggtcgacctccacgacaacaaggaagtc
cacatcttcgaaggtcagaacatcgataagctccgcaaagcttacaccttggactcctcc
ttcctctccgccatcgaagaagatcctttcgagaacctgcaagagacaggcgacctcttt
gcaaacagactcagcatcaccgccacgcgcccagagctggagctcgtccgccgcctcgca
gaactcatcggtacccgtgccgcccgcttgtccgcctgcggtgtcgcggccatctccaag
aagaaaggctacgacagctgccacgttggcgctgacgggtccgtcttcaacaagtacccg
cacttcaagcaacgtggcgccgctgccttgcgcgagattctggactgggccccgaagaag
agcagcaaggatgaagacccaattgagatcctggctgcggaggacgggagcggagttggt
gctgcattgattgcggcgttgacgctgaagcgcgtgaaggaggggaacatggcagggatt
ttgcacccggagaacttcaagtag

DBGET integrated database retrieval system