KEGG   Methanoculleus bourgensis: BN140_1458Help
Entry
BN140_1458        CDS       T02189                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mbg  Methanoculleus bourgensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN140_1458 (ppcA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1458 (ppcA)
   00680 Methane metabolism
    BN140_1458 (ppcA)
Enzymes [BR:mbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BN140_1458 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1490233..1491690
Genome map
AA seq 485 aa AA seqDB search
MLRIPQCMSTQHPDNVNLPFFAESPELGGEDEVQEAYYAYSHLGCTEQMWDCEGKEVDNF
VVRKLLSRYDAFFREKRLGRDVFLTLRVPNPEVETAEAKILLETLESIPRSYDTACLFYG
DECPPIFEVILPMTASHTAIDNIYRYYTDIVVGKQERSLGEGGMTIADWIGRFRPDRINV
IPLFEEMDHMLDAHNAVRRYLEGKDITHQRVFLARSDPAMNYGIVSAVLLNKIALQHLQE
VSEETGTGIYPIIGVGSAPFRGGLSPRTVDQVTAEYPSVHTFTVQSAFKYDYPLEEVQNA
VRRLEERRPGRPRPVDEAAALDLIERYTRAYERRLGPLAPLINRVARYVPERRKRKLHIG
LFGYARSTGGITLPRAIKFTAALYSVGFPPEILGLDALDDTDIGFVRETYVNFDENLKAA
ARYLNTETGLVPRELAARVADLVDIEPDEEHAEVTAEIARALRENDIGKLSALVLQAAHC
RKFLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctacggataccgcagtgtatgagcacccagcaccctgacaacgtcaacctgccgttc
tttgccgagagcccggaactcggcggtgaagacgaggttcaggaggcgtactacgcctat
tcccacctggggtgcaccgaacagatgtgggactgtgagggaaaagaggtcgacaacttt
gtggtcaggaaactcctctcccggtatgatgcgttcttcagggagaagagactcggcagg
gacgtcttcctgacgctccgggttccaaaccccgaggtcgagacggccgaggcaaagata
ctcctcgagacgctcgagagcatcccgcggtcgtatgatacggcgtgcctcttctacggg
gacgagtgtcccccgatattcgaggtcattctcccgatgacggcgtcccacactgccatc
gataatatctaccgctattataccgatatcgtcgtcgggaagcaggagagaagtctcggt
gagggcggcatgaccatcgcagactggatcgggaggttccggccggaccggatcaacgtc
atcccactctttgaagagatggaccatatgctggatgcgcacaacgcggtcaggcgctac
ctcgaagggaaggatatcacccaccagcgcgtctttctcgcccggtcggacccggcgatg
aactacgggatcgtcagcgcggtcctcctgaataagatcgcgctccagcacctccaggag
gtctcggaggagacggggacggggatatacccgatcatcggtgtgggttcggcgccgttt
cggggcggcctctcaccccggaccgtcgaccaggtcaccgccgaatacccgagcgtccat
acattcactgtccagtctgcgttcaagtatgactacccgctcgaagaggtccagaacgcg
gtccggagattggaggagcggaggcccggtagaccccgacccgtcgacgaggcggcggcg
ctcgacctgattgagaggtatacacgggcatacgagcgacggctcgggcctcttgccccc
ctgatcaaccgggttgcccgctacgttcctgagcggcggaagcggaaactgcatatcggt
ctcttcgggtatgcccggagcaccggcgggatcaccctgccgcgggcgatcaagttcacc
gctgccctctactcggtcgggttcccgcccgagatcctcggcctggatgcgctggacgat
acggatatcgggttcgtcagggagacctacgtcaacttcgacgagaacctgaaggccgct
gcccgctacctgaacacggagacggggctcgtcccccgggagcttgcggcccgggtggcc
gacctggtggatatcgagcctgacgaggagcatgcggaggtcacggccgagatcgcccgg
gcgctccgcgagaacgatatcgggaagttgagcgcccttgtcctgcaggcggcgcattgc
cggaagttcctggggtga

DBGET integrated database retrieval system