KEGG   Monosiga brevicollis: MONBRDRAFT_19231Help
Entry
MONBRDRAFT_19231  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 5887596
NCBI-ProteinID: XP_001742762
JGI: 19231
UniProt: A9UQ78
LinkDB All DBs
AA seq 501 aa AA seqDB search
MPSDLPADLRAETAVRIGELDALFEKLLPLIRQYEMAGGRPDTKVVEFKSPEDLRRLFPM
ALPEQGQGIDKAVAAINDMMLYSVRTSHPRFMNQLFAGSDPIGQIAELVTAILNVNCYTY
TVAPVFSMMEVEVMQRMADLAGFDVAESEGIMVPGGSYANLVGLITARHHHFPHVRLEGW
RGDERPVIFTSAQAHYSIRRNAMVLGLGMNAVVAVAADRSGHMLADDLVAKIAEARAKGQ
TPFAVSATAGTTIMGGFDDFNALADICQAENLWLHVDGAWGGACLLSDRLRSLMKGVERA
DSLAWDAHKGLGVPVLAAGILLNKHKGLLRASNNSSADYLFHPSSTSEYDLGDMTLQCGR
RADSIKVWLSWYYHGRAGLGARVEHAYDVAQYLHRKICKDPRFLVVAEPEYCNVTFWYLP
KCLRGTTAEDIEANYERLDQATQRTFVAMQQAGTMMFNFNPLTDLHLPRFFRLITNSPVL
QEKDMDFVIEELDRLAEDIVV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagacctcccggccgatctccgtgcggagacagcggtccgcatcggcgagctg
gacgccttgttcgaaaagctattaccactgattcgccagtacgaaatggccggtggtcgc
cccgataccaaggttgtcgagttcaaaagccccgaggacttgcgccggctctttccgatg
gccttgcccgaacaagggcaaggcatcgacaaggccgtggctgctatcaacgacatgatg
ttgtacagtgtccgcacatcgcatccccgctttatgaaccagctctttgccggcagtgac
cccattggccagattgccgagttggtgacagccatcttgaatgtcaactgctacacctac
accgttgctcctgtcttctccatgatggaggttgaagtcatgcaacgcatggccgatctg
gctggctttgatgtggccgaaagcgaaggcatcatggtgccgggaggcagctatgccaac
ctcgtcggcctgatcaccgcccgccatcaccactttccccatgtgcgcttggagggctgg
cgcggcgatgaacgcccagtcatcttcaccagcgcccaagcacactactctattcgccga
aacgccatggtcctcggcttgggcatgaatgcagtggttgccgtggctgccgatcgcagc
ggacacatgctagctgatgacctcgtggccaagattgccgaggcgcgcgccaagggccag
accccttttgccgtcagtgccacagctggcactaccattatgggcggctttgatgacttc
aacgcattggcagatatctgccaagctgaaaacctttggcttcatgtcgatggtgcttgg
ggtggcgcctgtttattgtcggaccgcctacgctccctcatgaagggcgtcgaacgcgcc
gactcactcgcctgggatgcccacaagggtctgggtgtccccgttttggcggccggaatc
ttgttgaacaagcacaaagggcttttgcgcgcctccaataacagctcagccgactacctg
tttcatccttcctccacatccgaatatgatcttggggacatgacgctgcaatgtggccgt
cgtgctgatagcatcaaagtctggctctcgtggtattaccacgggcgtgctggcctgggt
gcgcgcgttgagcatgcctatgatgtggcccagtatttgcatcgcaaaatttgcaaggac
ccgcgcttcttggtcgttgccgaacccgagtactgcaatgtcacgttttggtatctgccc
aaatgcctccgtggcacgacggcagaggacattgaagccaactacgagcgcttggatcag
gcaactcagcgcacgtttgttgcaatgcagcaggcgggaaccatgatgttcaatttcaac
ccgttgaccgacctgcacctaccacgcttctttcgcctgatcaccaactcccctgtgctg
caagaaaaggacatggattttgtgattgaagagctggaccggctggctgaggatattgtg
gtctag

DBGET integrated database retrieval system