KEGG   Monosiga brevicollis: MONBRDRAFT_28715Help
Entry
MONBRDRAFT_28715  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 327 aa AA seqDB search
MPTLASHWAVYARVSCLRTVFEGGKEGYFCYRIPSLVQLGPDSYIAFAEGRKFSCEDHGW
NDIVAKTSSDGGQTWSALAVVYGESSTKANITIGNPAPVVLHDGTLLLVFCRNNQAMLLL
NSTDGGQTWGGFRDVSAGIVDPTWPFFATGPPGSIQLHTGRILVPADHTSGSTQSMAIYS
DDYGQTWTRGAMIPDGNECQAVELPDGTVMMNMRTSQAHRQVAFSKDGGATWSDPVVTVN
GTVCEGSTIMLPDSTGTLVQSFPNSNDRANVSIQTSTDGLSWGNSIQVYAGSSAYSSLQQ
ANNNTAVALLLEMDSYQKIAFAMVSLV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcccacactggcttcacattgggccgtgtatgcacgagtgtcgtgcttgcgtacggtc
tttgagggtggcaaagaggggtacttttgctaccgtatcccatccctcgtgcaacttggt
cccgactcgtacattgcctttgccgaagggcgcaaattctcgtgtgaagatcatggttgg
aatgacattgtggccaaaaccagcagcgatggagggcaaacgtggtcagcgctggccgtg
gtgtacggtgaatcctcgaccaaggcgaacatcaccataggcaaccccgcgcccgttgtg
ctccatgatgggacccttttgctcgttttctgccgcaacaaccaggccatgctgcttctc
aatagcactgatggtggccaaacgtggggcggctttcgtgatgtgagcgccggcatcgtc
gaccccacttggcctttctttgccaccggtccgccgggcagtattcagttgcatactggt
cgaatcttggtgcccgccgatcatacaagcgggtcaactcagtccatggccatttatagc
gacgactatggtcaaacgtggactcgaggtgctatgattcccgacggaaacgaatgccag
gctgtggaactgcccgatggtaccgttatgatgaacatgcgtacctcgcaagctcatcgt
caggtcgcgttttccaaggatggtggcgccacatggagcgatcccgttgtgacggtcaac
ggaacggtttgcgaaggctcgacgatcatgctgcccgactcgacaggcactcttgtccag
tcctttcccaattccaacgatcgtgccaatgtcagcattcagacttcgacggacggcctg
tcatggggcaactcaattcaggtgtacgctggatcaagcgcctactcctcactgcagcag
gcgaacaataacacggctgtagctctgctgttggagatggatagctaccaaaaaattgcc
tttgccatggtctcactcgtttga

DBGET integrated database retrieval system