Mus caroli (Ryukyu mouse): 110285703 Help Entry 110285703         CDS       T05910                                  Symbol Rela Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01523   Antifolate resistance mcal04010   MAPK signaling pathway mcal04014   Ras signaling pathway mcal04024   cAMP signaling pathway mcal04062   Chemokine signaling pathway mcal04064   NF-kappa B signaling pathway mcal04066   HIF-1 signaling pathway mcal04071   Sphingolipid signaling pathway mcal04137   Mitophagy - animal mcal04151   PI3K-Akt signaling pathway mcal04210   Apoptosis mcal04211   Longevity regulating pathway mcal04218   Cellular senescence mcal04380   Osteoclast differentiation mcal04613   Neutrophil extracellular trap formation mcal04620   Toll-like receptor signaling pathway mcal04621   NOD-like receptor signaling pathway mcal04622   RIG-I-like receptor signaling pathway mcal04623   Cytosolic DNA-sensing pathway mcal04625   C-type lectin receptor signaling pathway mcal04657   IL-17 signaling pathway mcal04658   Th1 and Th2 cell differentiation mcal04659   Th17 cell differentiation mcal04660   T cell receptor signaling pathway mcal04662   B cell receptor signaling pathway mcal04668   TNF signaling pathway mcal04722   Neurotrophin signaling pathway mcal04917   Prolactin signaling pathway mcal04920   Adipocytokine signaling pathway mcal04926   Relaxin signaling pathway mcal04931   Insulin resistance mcal04932   Non-alcoholic fatty liver disease mcal04933   AGE-RAGE signaling pathway in diabetic complications mcal04936   Alcoholic liver disease mcal05010   Alzheimer disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05030   Cocaine addiction mcal05132   Salmonella infection mcal05133   Pertussis mcal05134   Legionellosis mcal05135   Yersinia infection mcal05140   Leishmaniasis mcal05142   Chagas disease mcal05145   Toxoplasmosis mcal05146   Amoebiasis mcal05152   Tuberculosis mcal05160   Hepatitis C mcal05161   Hepatitis B mcal05162   Measles mcal05163   Human cytomegalovirus infection mcal05164   Influenza A mcal05165   Human papillomavirus infection mcal05166   Human T-cell leukemia virus 1 infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05168   Herpes simplex virus 1 infection mcal05169   Epstein-Barr virus infection mcal05170   Human immunodeficiency virus 1 infection mcal05171   Coronavirus disease - COVID-19 mcal05200   Pathways in cancer mcal05202   Transcriptional misregulation in cancer mcal05203   Viral carcinogenesis mcal05207   Chemical carcinogenesis - receptor activation mcal05208   Chemical carcinogenesis - reactive oxygen species mcal05212   Pancreatic cancer mcal05215   Prostate cancer mcal05220   Chronic myeloid leukemia mcal05221   Acute myeloid leukemia mcal05222   Small cell lung cancer mcal05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcal05321   Inflammatory bowel disease mcal05415   Diabetic cardiomyopathy mcal05417   Lipid and atherosclerosis mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110285703 (Rela)    04014 Ras signaling pathway     110285703 (Rela)    04064 NF-kappa B signaling pathway     110285703 (Rela)    04668 TNF signaling pathway     110285703 (Rela)    04066 HIF-1 signaling pathway     110285703 (Rela)    04071 Sphingolipid signaling pathway     110285703 (Rela)    04024 cAMP signaling pathway     110285703 (Rela)    04151 PI3K-Akt signaling pathway     110285703 (Rela)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     110285703 (Rela)   09143 Cell growth and death    04210 Apoptosis     110285703 (Rela)    04218 Cellular senescence     110285703 (Rela)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110285703 (Rela)    04620 Toll-like receptor signaling pathway     110285703 (Rela)    04621 NOD-like receptor signaling pathway     110285703 (Rela)    04622 RIG-I-like receptor signaling pathway     110285703 (Rela)    04623 Cytosolic DNA-sensing pathway     110285703 (Rela)    04625 C-type lectin receptor signaling pathway     110285703 (Rela)    04660 T cell receptor signaling pathway     110285703 (Rela)    04658 Th1 and Th2 cell differentiation     110285703 (Rela)    04659 Th17 cell differentiation     110285703 (Rela)    04657 IL-17 signaling pathway     110285703 (Rela)    04662 B cell receptor signaling pathway     110285703 (Rela)    04062 Chemokine signaling pathway     110285703 (Rela)   09152 Endocrine system    04920 Adipocytokine signaling pathway     110285703 (Rela)    04917 Prolactin signaling pathway     110285703 (Rela)    04926 Relaxin signaling pathway     110285703 (Rela)   09156 Nervous system    04722 Neurotrophin signaling pathway     110285703 (Rela)   09158 Development and regeneration    04380 Osteoclast differentiation     110285703 (Rela)   09149 Aging    04211 Longevity regulating pathway     110285703 (Rela)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110285703 (Rela)    05202 Transcriptional misregulation in cancer     110285703 (Rela)    05207 Chemical carcinogenesis - receptor activation     110285703 (Rela)    05208 Chemical carcinogenesis - reactive oxygen species     110285703 (Rela)    05203 Viral carcinogenesis     110285703 (Rela)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110285703 (Rela)   09162 Cancer: specific types    05212 Pancreatic cancer     110285703 (Rela)    05221 Acute myeloid leukemia     110285703 (Rela)    05220 Chronic myeloid leukemia     110285703 (Rela)    05215 Prostate cancer     110285703 (Rela)    05222 Small cell lung cancer     110285703 (Rela)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110285703 (Rela)    05170 Human immunodeficiency virus 1 infection     110285703 (Rela)    05161 Hepatitis B     110285703 (Rela)    05160 Hepatitis C     110285703 (Rela)    05171 Coronavirus disease - COVID-19     110285703 (Rela)    05164 Influenza A     110285703 (Rela)    05162 Measles     110285703 (Rela)    05168 Herpes simplex virus 1 infection     110285703 (Rela)    05163 Human cytomegalovirus infection     110285703 (Rela)    05167 Kaposi sarcoma-associated herpesvirus infection     110285703 (Rela)    05169 Epstein-Barr virus infection     110285703 (Rela)    05165 Human papillomavirus infection     110285703 (Rela)   09171 Infectious disease: bacterial    05132 Salmonella infection     110285703 (Rela)    05135 Yersinia infection     110285703 (Rela)    05133 Pertussis     110285703 (Rela)    05134 Legionellosis     110285703 (Rela)    05152 Tuberculosis     110285703 (Rela)   09174 Infectious disease: parasitic    05146 Amoebiasis     110285703 (Rela)    05145 Toxoplasmosis     110285703 (Rela)    05140 Leishmaniasis     110285703 (Rela)    05142 Chagas disease     110285703 (Rela)   09163 Immune disease    05321 Inflammatory bowel disease     110285703 (Rela)   09164 Neurodegenerative disease    05010 Alzheimer disease     110285703 (Rela)    05022 Pathways of neurodegeneration - multiple diseases     110285703 (Rela)   09165 Substance dependence    05030 Cocaine addiction     110285703 (Rela)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110285703 (Rela)    05418 Fluid shear stress and atherosclerosis     110285703 (Rela)    05415 Diabetic cardiomyopathy     110285703 (Rela)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110285703 (Rela)    04932 Non-alcoholic fatty liver disease     110285703 (Rela)    04931 Insulin resistance     110285703 (Rela)    04933 AGE-RAGE signaling pathway in diabetic complications     110285703 (Rela)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     110285703 (Rela)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mcal03000]     110285703 (Rela) Transcription factors [BR:mcal03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     110285703 (Rela) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  110285703 NCBI-ProteinID:  XP_021007720 Ensembl:  MGP_CAROLIEiJ_G0022562 UniProt:  A0A6P5P231 LinkDB All DBs Position 19:2386344..2396786 Genome browser AA seq 549 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDSAGRPLLLTPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF DEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPVPVLTPGPPQSLS APVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQG VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDF SALLSQISS NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt atggacgatctgtttcccctcatctttccctcagagccagcccaggcttctgggccttat gtggagatcattgaacagcccaagcaacggggcatgcgattccgctataaatgcgagggg cgctcagcgggcagtattcctggtgagagaagcacagataccaccaagacacaccccacc atcaagatcaatggctacacaggaccaggaacagttcgaatctccctagtcaccaaggat ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggatggctactat gaggctgacctctgcccagaccgctgtatccatagcttccagaacctggggatccagtgt gtgaagaagcgagacctggagcaagccattagccagcgaatccagaccaacaataacccc tttcacgttcccatagaggagcagcgcggggactatgacttgaatgcagtgcgcctctgc ttccaagtgacagtgcgggactcagcaggcaggcccctccttctgacccctgtcctctca catccgatttttgataaccgggcccccaacactgccgagctcaagatctgccgagtaaac cggaactccgggagctgcctcggtggggatgagatcttcttgctgtgtgacaaggtgcag aaagaagacattgaggtgtatttcacgggaccaggctgggaggcacgaggctccttttct caagctgatgtgcaccggcaagtggccattgtgttccggactcctccgtacgctgacccc agcctacaggctcctgtgcgagtgtccatgcagctgcggcggccttctgatcgggagctc agcgagcccatggagttccagtacttgccagacacagatgaccgccaccgaattgaagag aagcgcaaaaggacatatgagaccttcaagagtatcatgaagaagagtcctttcaatgga ccaactgaaccccggcctccaacccggcgtattgctgtgcctacccgaaactcaacttct gtccccaagccagccccgcagccctacaccttcccagcatccctcagcaccatcaacttt gatgagttttcccccatgctgttaccatccgggcagatctcaaaccaggccctggccttg gcaccgtcctctgccccagtccttgcccagaccatggtcccttcctcagccatggtacct ctggctcagcccccagctcctgtcccagttctaaccccgggtcctccccagtccctgtct gcacctgttccaaagagcacccaggctggggaaggcacgctgtcggaagccctgctgcac ctgcagtttgatgctgatgaagacttgggggccttgcttggcaacagcacagacccagga gtgttcacagacctggcatctgtggacaattcagagtttcaacagctcctgaaccagggc gtgtccatgtctcactccacagctgagcccatgctcatggagtaccctgaagctataacg cgcctggtgacagggtcccagaggccccctgacccagctcccacacccctggggacctcg gggcttcccaatggtctctccggagatgaagacttctcctccattgcggacatggacttc tctgctcttttgagtcagatcagctcctaa

DBGET integrated database retrieval system