KEGG   Mycobacterium chubuense: Mycch_4291Help
Entry
Mycch_4291        CDS       T02150                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Mycch_4291
Enzymes [BR:mcb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mycch_4291
DNA repair and recombination proteins [BR:mcb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Mycch_4291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFM19005
UniProt: I4BNZ8
LinkDB All DBs
Position
complement(4500799..4503045)
Genome map
AA seq 748 aa AA seqDB search
MKLTNADKVLYPATGTTKGDVFEYYVRVAEAMLPHIAGRPVTRKRWPNGVEEGSFFEKQL
ASSAPEWLDRGTIVHKSGTTTYPVIDTAEGLAWIAQQASLEVHVPQWRFDDTGSVGPATR
IVFDLDPGEGVSMRQLCEVAHEVRDLITDIGLQTFPLTSGSKGLHLYVPLQDPISSRGAS
VLAKRVAQQLEQTMPKRVTATMTRSLRDGKVFLDWSQNNGNKTTIAPYSLRGREHPTVAA
PRTWEEIEDPKLRHLTYDEVLDRLERDGDLLAELDDPLPVPDRLTTYRSMRDTARTPEPV
PKQSPEVGNNDKFVIQEHHARRLHYDFRLERDGVLVSWAVPKNLPETPSVNHLAVHTEDH
PMEYLTFAGEIPKGEYGGGQVYVWDTGTYETEKFRDNPPDGPAKGGEVIVTLHGEKVEGR
YALIQTDGKNWLAHRMKDQKHPTFADLVPMLTTEGSVERLSKGQWAFEGKWDGYRILVEA
DHGKLTVRSRRGRDVTAEYPQFQAIAADLADHHVILDGEAVALDESGVPSFREMQNRARS
TRVEFWAFDILYLDGRSLMRAKYTDRRRVLETLAEGGGLIVPAAIEGDGPQALAYAEKKR
WEGVVAKKKDSTYQAGRRSSSWIKDKLWNTQEVVIGGWRQGNGGRTSGIGALMLGIPGEG
GLQFVGRVGTGFTEKELASLKETLTPLRSDESPFSARLPTQDAKGVTFVRPELVGEVRYS
ERTGDGRLRQPSWRGLRPDKGPGEVRWE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgaccaacgcggacaaggtgctctacccggccacgggtaccaccaagggtgac
gtgttcgagtattacgtgcgcgtcgccgaggcgatgctgcctcacatcgccggccggccc
gtgacgcgcaagcgctggcccaacggcgtcgaggaaggatcgttcttcgagaagcaactg
gcctcgtcggccccggagtggctggaccggggcaccatcgtccacaagtcgggcaccacc
acctacccggtcatcgacacggccgaaggactggcctggatcgcgcagcaggcgtcgctg
gaagtgcatgtgccacagtggcgattcgacgacaccggttcggtgggcccggccacgcgc
atcgtgttcgacctcgatccaggcgagggggtgtcgatgcgtcagctctgcgaggtcgcc
cacgaggtgcgggacctgataaccgacatcggactgcagaccttcccgctgaccagtggc
agcaaggggctgcacctctatgtcccgctgcaggatccgatcagctcgcgcggcgcttcc
gtgctggccaagcgggtcgcccagcagctcgagcagacgatgcccaagcgcgtcacggcg
acgatgacccggagtctgcgcgacggcaaggtgttcctggactggagtcagaacaacggc
aacaagacgacgatcgcgccgtattcgcttcgcggacgcgagcatccgaccgtggcagca
ccgagaacgtgggaggagatcgaggatccgaagctgcgtcacctgacctacgacgaggtg
ctcgaccgactcgagcgagacggcgacctgctcgccgaactcgacgacccgctacccgtc
cccgaccggctgacgacataccggagcatgcgcgacaccgctcgtactccggagccggtc
ccgaagcagtcgccggaggtcggcaacaacgacaagttcgtcatccaggagcaccatgcc
cggcgtctgcactacgacttccggctggagcgcgacggcgtcctggtcagctgggcggtg
ccgaagaaccttccggagacaccgtcggtcaaccacctcgccgtgcacaccgaagaccat
ccgatggagtatctgacgttcgccggcgagatcccgaagggggaatacggcggcggacag
gtctacgtctgggacaccggaacctatgagaccgagaagttcagggacaacccgcccgac
ggtccggccaaaggcggcgaggtcatcgtcacgctgcacggcgagaaggtcgaaggccgc
tatgcgttgatccagaccgatggcaagaactggcttgcgcaccggatgaaagatcagaag
cacccgacgttcgccgatctggtgccgatgctgaccaccgaaggctcggtcgagcgactg
tccaaggggcagtgggcttttgaaggaaagtgggacgggtaccggatactcgtcgaggcc
gaccacggcaagctgacggtgcggtcccggcgaggtcgcgacgtgaccgccgagtacccg
cagttccaggcgatcgccgcggatctcgccgatcaccacgtgatcctcgacggggaggct
gtcgcgctcgacgagtcgggtgtgccgagctttcgcgagatgcagaaccgtgcgcgctcc
acccgcgtggagttctgggcgttcgacatcctctacctggacgggcgctccctgatgcgc
gccaagtacaccgaccgcaggcgcgtgctcgaaaccctggccgagggcggtggtctcatc
gtgcccgcagcgatcgagggggacggtccgcaggctctggcgtatgcggagaagaagcgg
tgggaaggcgtcgtcgccaagaagaaggactccacctatcaggccggccggcgttcgtcg
tcgtggatcaaggacaagctgtggaacacgcaggaagtcgtgatcggcggctggcgccag
ggcaacggcggacgcacgagtggaatcggtgcgctgatgctcgggatccccggcgagggc
ggtctgcagttcgtcggacgcgtcggcaccggcttcaccgagaaggagctcgcgtctctg
aaggagacgctcacgccgctgcgcagtgacgaatcgcccttcagtgcacggcttcccact
caagacgcgaagggggtcacgttcgtgcggccggagttggtgggggaggtgcgctacagc
gagcgcaccggcgatggccggctgcggcaaccgagttggcggggactgcggccggacaag
gggcccggcgaagtcaggtgggagtga

DBGET integrated database retrieval system