KEGG   Mycobacterium chubuense: Mycch_4875Help
Entry
Mycch_4875        CDS       T02150                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
mcb  Mycobacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5117440..5118483)
Genome map
AA seq 347 aa AA seqDB search
MASAATELDVDGVKVRLTNPDKPYFPKLGKDGTKGKLVEYYLSVAEPMVSLLRDRPVHLQ
RFPDGIEGEEIYQKRLPQKRPDYLQACTVTFPSGRTADTLKVTHPSAIAWAAQMGSVTLH
PWQVRCPDTEHPDELRIDFDPQPGTDFSDARVIAVDVLKPLLDELGLVGYPKTSGGRGVH
VFLRIAADWDFIAVRRAGIALAREIERRAPDAVTTEWWKENRGARVFIDYNQNARDRTFA
SAYSARKTPIATVSTPLTWDELRDAEPDDYTIVTVPDFVAGRPDPWAAIETAAQSIEPLL
QMVAADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEDGNRV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgcggcaaccgaactcgatgtcgacggggtcaaggtccgactgaccaacccc
gacaagccgtacttccccaagctcggcaaggacgggaccaaggggaaactcgtcgagtac
tacctgtcggtggccgagccgatggtgtccctgctgcgcgaccggccggtgcatctgcag
cggttccccgacggcatcgagggcgaggagatctaccagaaacgcctgccgcagaagcga
cccgactatctgcaggcctgcaccgtgaccttcccgtcgggccgaaccgccgacacgctg
aaggtcacgcacccctcggcgatcgcgtgggcggcacagatgggttcggtgaccctgcac
ccgtggcaggtgcgttgcccggacaccgagcatccggacgagttgcgcatcgacttcgac
ccgcagccaggcaccgacttctccgacgcccgcgtgatcgccgtggacgtgctcaaacca
ctcctcgacgaactcggtctggtcggctacccgaagacctcgggcggccgcggggtgcat
gtctttctgcgcatcgccgccgactgggacttcatcgcggtgcggcgggcgggcatcgcg
ctggcgcgcgagatcgagcggcgcgcaccggacgccgtgacgacggagtggtggaaagaa
aaccggggtgcgcgggttttcatcgattacaaccagaacgcgcgagaccgcaccttcgcg
tcggcgtactcggcgcgcaagaccccgatcgcgacggtgtcgacgccgctgacctgggac
gagttgcgcgacgccgagcccgacgactacacgatcgtcaccgtgcccgatttcgttgcg
ggccggcctgacccgtgggccgctatcgagaccgctgcgcagtcgatcgaacccttgctg
cagatggtggccgcggacgaggagcgcgggctcggcgacctgccctacccgccgaactac
cccaagatgccgggcgaaccgccacgggtgcagccgagcaagaaagtggctgagcactgg
gacgaggacggaaaccgggtttag

DBGET integrated database retrieval system