KEGG   Mycobacterium chubuense: Mycch_4881Help
Entry
Mycch_4881        CDS       T02150                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mcb  Mycobacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5124195..5125280
Genome map
AA seq 361 aa AA seqDB search
MAAMKLPVMPPVSPMLAKPVAEMPPDASYEPKWDGFRSILFRDGDDVELGSRNERPMTRY
FPELVDAARTELPPRCVIDGEIVIATPEGLDFEALQLRLHPAASRVRLLAGQTPASFIAF
DLLALDDCDYTSRPFGERRAALVETLAGSGPTIHVTPATTDIRIARRWFSEFEGAGLDGI
IAKPLNLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGDDAIGSLLLGLYTDGGALASVG
VIGAFPMATRRALFTELQPLVTTFDDHPWNWAAQAAADPALARRYGVGSRWNAGKDLSFV
PLRPERVVEVRYDHMEGKRFRHTAQFNRWRPDRDPRSCTYAQLEQPLTFRLDDIVPGLGR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgatgaagcttcctgtgatgccgccggtctcgccgatgctggcgaagccggtc
gcagagatgccgccggacgcgtcctacgagcccaagtgggacggtttccggtcgatcctg
ttccgcgacggcgacgatgtggagctgggcagccgcaacgagcgcccgatgacgaggtac
ttcccggaactggtcgacgcggcccgcacggagttgccaccgcgctgcgtgatcgacgga
gagatcgtgatcgccacccccgaagggctcgacttcgaggcgctgcaactgcgtctgcat
cccgccgcgtcgcgggtacggttgctggccggccagacgccggcgtcgttcatcgcgttc
gatctgctcgcgctcgacgactgcgactacacgtcgcggcccttcggtgagcggcgggcg
gcgctggtcgagacgttggccggttccgggccgaccattcacgtcaccccggcgaccacc
gacatcagaatcgcgcggcgctggttctccgagttcgagggcgccggcctcgacggcatc
atcgccaaaccgctgaatctgacctaccagccggacaagcgggtgatgttcaaggtcaaa
caccagcgcaccgccgactgcgtggtcgccgggtaccggctgcacaagtcgggcgacgac
gcgatcggctcgctgctgctcgggctctacaccgacggcggcgctctggcgtcggtggga
gtcatcggcgcgttcccgatggcgacgcggcgcgcgctcttcaccgagttgcagccgctg
gtgacgaccttcgacgaccacccgtggaactgggcggcgcaggcggctgccgatcccgcg
ctggcgcgcagatacggtgtcggctcgcggtggaacgccggcaaggacctgtcgttcgtg
ccgttgcggcccgagcgcgtcgtcgaggtgcgttacgaccacatggaaggcaaaaggttc
cgtcacacagcgcagttcaaccgctggcgaccggaccgcgacccgcgctcgtgcacctac
gcccagctcgagcagccgctgacgttccgtctggatgacatcgtgccgggacttggccgt
ccttga

DBGET integrated database retrieval system