Macaca mulatta (rhesus monkey): 100430668 Help Entry 100430668         CDS       T01028                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05202   Transcriptional misregulation in cancer mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100430668  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100430668   09163 Immune disease    05322 Systemic lupus erythematosus     100430668   09165 Substance dependence    05034 Alcoholism     100430668  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     100430668   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     100430668 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100430668 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100430668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  100430668 NCBI-ProteinID:  XP_028703598 LinkDB All DBs Position 4:142314604..142315784 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcggacgaagcagacagcccgcaagtccaccggcggcaaggcaccgcggaagcag ctggccaccaaggcagcgcgcaaaagcgctccagcgactggcggtgtgaagaagccccac cgctaccggccaggcactgtggccttgcgcgagatccgccgttatcagaagtcgactgag ctgctcatccgcaaactgccatttcagcgcctggtgcgagaaatcgcgcaggatttcaaa actgaccttcgtttccagagctcggcggtgatggcgctgcaagaggcgtgcgaggcctat ctggtggggctctttgaggacaccaatctctgtgccattcacgccaagcgcgtcactatt atgcctaaggacatccagcttgcgcgtcgtattcgtggtgagcgagcataa

DBGET integrated database retrieval system