KEGG   Macaca mulatta (rhesus monkey): 574097Help
Entry
574097            CDS       T01028                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04068  FoxO signaling pathway
mcc04146  Peroxisome
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    574097 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    574097 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    574097 (SOD2)
   04213 Longevity regulating pathway - multiple species
    574097 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    574097 (SOD2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     574097 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 574097
NCBI-ProteinID: NP_001027977
Ensembl: ENSMMUG00000038719
UniProt: H9EUV0
LinkDB All DBs
Position
4
AA seq 222 aa AA seqDB search
MLSRAVCGTGRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtttgcggcaccggcaggcagttggcgccggctttggggtatctg
ggctccaggcagaaacacagcctccccgacctgccctacgactacggcgccctggagcct
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgttaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaatggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgaaaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggttttaataaggaacggggacagttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattac
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system