Macaca mulatta (rhesus monkey): 699110 Help Entry 699110            CDS       T01028                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     699110  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     699110   09163 Immune disease    05322 Systemic lupus erythematosus     699110   09165 Substance dependence    05034 Alcoholism     699110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     699110 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     699110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  699110 NCBI-ProteinID:  XP_001088506 Ensembl:  ENSMMUG00000047819 UniProt:  F7HAP8 A0A8J8XEY8 LinkDB All DBs Position 4:143710096..143713805 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaagggtgggaaaggcttaggtaagggaggcgctaagcgtcaccgc aaggttttgcgggacaacattcagggcatcactaagccagccatccgccgccttgctcgc cgcggcggtgtcaagcgtatttctggccttatctatgaggagacccgtggtgttctgaag gtgttcctggagaacgtgattcgtgatgcagtcacttacacggagcatgctaaacgcaag actgtaacagcaatggatgtggtctatgcgctgaagcgacagggacgcactctttacggc ttcggtggttaa

DBGET integrated database retrieval system