KEGG   Methylobacterium extorquens CM4: Mchl_2137Help
Entry
Mchl_2137         CDS       T00809                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mchl_2137
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mchl_2137
   00680 Methane metabolism
    Mchl_2137
Enzymes [BR:mch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mchl_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2235492..2238260
Genome map
AA seq 922 aa AA seqDB search
MTKTLHARPSAATDTTFAPPVITGTATEDALEILFHALLDVARRHDPELEDVLHGRADIS
SFTPEMLARALQVQGIWFQLVSIAEQNAAMRRRRHVERDQGREALNGSFAKVLAEASARG
IGPQQIHALLKDLRIRPTITAHPTEGKRVTVLEKLRRIYLVLRELELPRWTERERNGLMN
ELRDQIELIWMTGELHLEKATVEREVAWGLHFFDETLFEMLPEMLLSLEESLAQYYPDET
FEVPPFFQFGSWIGGDRDGNPYVTASVTRETLQRNALASLRRYRDGITHLGRVLSITERS
LPVPETFRSELAHMLAESGDARAIANRNPGEAYRQFLSCVLRKLEATIARNKGARSVGPD
YPSADGLINDLRTLEKGLADAKCGALATDIVRPVRRMVEIFRFSTVRLDLRENSTRTTKT
LHALWKLRNGDREPPALDSPAWKDWLLTELARPRTPETSFEDFADRLPDDARETLATFAL
VGEMRDTLDREAFGAFILSMTRSTVDVLGAYLLAKEAGIFLDTTGTEICPLPIVPLFETI
DDLRAAPAIMKELLGIPVVRRSTRWQGGVQEVMIGYSDSNKDGGFIASNWELYKAQVRLT
TLGNHLGVPIAFFHGRGGSVSRGGVPTHRGIAAQPPGSIQGRFRITEQGEVVSFKYANRG
TAAYQMELLAASVFEHALLSEGNGNGSRAEFDDALEALSGASRAAYVNLLQAEGLVDYFQ
AASPLDEISLLNIGSRPARRFGAKSLSDLRAIPWVFAWSQNRHVITGWYGVGSGLKSFID
VRGEAGEALLRRLFRDCRVFRLVLDEVEKTLLMVDLEIARDYAGLVEDAGIRARIFGMIE
AEYALTREMVLRVSGDSELAQRFPQFSERLRGRLPTINQVSREQVELLRRYRSETDEDKR
EAVKSALLLSINCIAVGFGATG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgctgcacgcccggccgtcagccgcgaccgacacgaccttcgcgccgccg
gtcatcactggcacggccaccgaggacgccctcgagattctgtttcacgccctgctcgac
gtggcccgccgccacgatcccgagctggaggacgtgctgcacggccgcgccgacatctcc
tccttcacgccggagatgctggcgcgcgcgcttcaggtgcagggtatctggtttcagctc
gtctcgatcgccgagcagaacgcggccatgcgccgccgccgccacgtcgagcgcgaccag
ggccgtgaggcgctgaacggctccttcgccaaggttctggccgaggcctccgcccggggc
atcggcccgcagcagatccacgcgctgctcaaggatctgcgcatccgcccgaccatcacc
gcgcatcccaccgagggcaagcgcgtcacggtgctggagaagctgcgccggatctacctc
gtgctgcgtgagctggagctgccgcgctggaccgagcgcgagcgcaacggcctgatgaac
gagcttcgtgaccagatcgagctgatctggatgacgggcgagctgcatctggagaaggct
accgtcgagcgcgaggtcgcctggggcctgcacttcttcgacgagaccctgttcgagatg
ctgcccgagatgctgctctcgctcgaagagagcctcgcgcagtattatcccgacgagacc
ttcgaggtgccgccgttcttccagttcggaagctggatcggcggtgaccgcgacggcaac
ccctacgtcaccgccagcgtgacccgcgagacgcttcagcgcaacgcgctggcgtcgctc
cgccgctaccgcgacggcatcacccatctcggccgggtgctctcgattaccgagcgctcg
ctgccggtgcccgagaccttccgcagcgaactcgcgcatatgctggccgagtccggcgat
gcgcgggcgatcgccaaccgcaatcccggcgaggcctatcgccagttcctctcctgcgtg
ctgcgcaagctcgaggcgacgatcgcccgcaacaagggcgcccgctcggtcgggccggat
tatccgagcgccgacgggctcatcaacgatctgcgcaccctggagaaggggctggccgac
gccaaatgcggcgcgctcgccaccgacatcgtgcggcccgtgcggcggatggtcgagatc
ttccgcttctccaccgtgcggctcgatctgcgcgagaattcgacccgcaccaccaagacg
ctgcacgcgctgtggaagctgcgcaacggcgaccgcgagccgccggcgctggattcgccg
gcctggaaggattggctgctcaccgagctggcccggccgcgcacgcccgaaacctcgttc
gaggatttcgccgaccgtctgcccgacgacgcgcgcgagacgctcgccaccttcgcgctg
gtcggcgagatgcgcgacactctcgaccgcgaggccttcggcgccttcatcctgtcgatg
acgcgctccaccgtcgacgtgctcggcgcctaccttctggccaaggaggccggcatcttc
ctcgacacgaccggcaccgagatctgcccgctgccgatcgtgccgctgttcgagaccatc
gacgacctgcgcgccgccccggcgatcatgaaggaactgctcggcatccccgtggtgcgc
cgctccacccgctggcagggcggggtgcaggaagtgatgatcggctactccgattccaac
aaggacggcggcttcatcgcctcgaactgggaactctacaaggcgcaggtgcggctgacc
acgctcggcaaccatctcggcgtgccgatcgccttcttccacggccgcggcggttcggtg
agccgcggcggcgtgccgacccatcgcggcatcgccgcccagccgccgggctcgatccag
ggccgcttccgcattaccgagcagggcgaggtcgtctcgttcaaatacgccaaccgcggc
accgccgcctaccagatggagctgctggcggcctcggtgttcgagcacgccctgctctcg
gagggcaacggcaacggctcgcgcgccgaattcgacgacgcgctggaggcgctctcgggc
gcctcgcgggcggcctacgtcaacctgctccaggccgagggcctcgtagattacttccag
gcggcgagcccgctcgacgagatctcgctgctcaatatcggctcgcgcccggcccggcgc
ttcggcgccaagtcgctctcggatctgcgcgcgatcccctgggtgttcgcgtggtcgcag
aaccggcacgtcatcaccggctggtatggcgtcggctcggggctgaagagcttcatcgac
gtgcgcggcgaggcgggcgaagccctgctgaggcgcctgttccgggattgccgggtgttc
cgcctcgtcctcgacgaggtcgagaagacgctgctgatggtcgatctcgagatcgcccgc
gactatgccggcctcgtcgaggacgcgggcatccgcgcgcgcatcttcgggatgatcgag
gcggaatacgcgctgacgcgggagatggtcctgcgggtgtcgggcgacagcgaactcgcc
cagcgcttcccgcaattcagcgaacgcctgcgcgggcggctgccgaccatcaatcaggtc
agccgcgagcaggtcgagctgctgcgccgctaccgcagcgagaccgacgaggacaagcgc
gaggcggtgaagtccgcgctgctgctgtcgatcaactgcatcgccgtcggcttcggcgcg
actggataa

DBGET integrated database retrieval system