KEGG   Mycobacterium chimaera: AN480_01630Help
Entry
AN480_01630       CDS       T04926                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
335653..336684
Genome map
AA seq 343 aa AA seqDB search
MAAAEEVDVDGVAVRLTNPDKVYFPKLGSRGTKRHLVEYYRAVAGGPMLDTLRDRPSHLQ
RFPDGIDGEEIYQKRIPQHHPDYLETCQVTFPSGRTADALKVTHPAAIVWAAQMGTITLH
PWQVRCPDTDHPDELRIDLDPQPGVAFEQARTVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTAWWKEERGQRIFVDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDELAGAEPDDYTMATVPELVARREDPWAAMDDVAQSIASLL
QMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDRRNGKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagaagaggtcgacgtcgacggtgtcgcggtccgcctgaccaatcccgac
aaggtgtatttccccaagctgggatcgcggggcaccaagcggcacctggtcgagtactac
cgcgccgtcgccggcggcccgatgctcgacacgctgcgcgaccggcccagccacctgcag
cggttcccggacggcatcgacggcgaggagatctatcagaagcggatcccgcagcaccat
ccggactacttggagacgtgccaggtgacgttcccgtcggggcggaccgccgacgcgctg
aaggtcacccatcccgccgcgatcgtgtgggcggcgcagatgggcacgatcaccctgcac
ccgtggcaggtgcgctgccccgacaccgaccaccccgacgagctgcgcatcgatctggat
ccgcagcccggcgtcgccttcgaacaggcgcgcaccgtcgcggtcgacgtgttgcggccg
ctgctcgacgagctcggtctggtcggctacccgaagacatccgggggtcgcgggatccac
gtcttcctgcggatcgccaccgactgggatttcgtcgaggtgcgccgcgcgggcatcgcg
ctggcccgtgaagtggagcgccgtgcgcccgacgccgtcaccaccgcatggtggaaggaa
gaacggggccagcgcatcttcgtcgacttcaaccagaacgcccgggaccggaccatggcg
tcggcctattcggtgcgacgcacgccgatcgcgacggtgtcgatgccgctgacttgggac
gaattggccggtgccgagccggacgactacaccatggcgaccgtgcccgagctggtcgcg
cgccgggaagacccttgggccgcaatggatgatgttgcccagtcgatcgcgtcgctgctg
caaatggccgaggccgacgaagagcgtggcttgggtgacatgccgtatccgccgaactat
ccgaagatgcccggggaacccaaacgcgttcagcccagccgggatacggatcgcaggaac
gggaagaagtag

DBGET integrated database retrieval system