KEGG   Mycobacterium chimaera: AN480_28580Help
Entry
AN480_28580       CDS       T04926                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mchi  Mycobacterium chimaera
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mchi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AN480_28580
Enzymes [BR:mchi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AN480_28580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
unnamed1:330049..330474
Genome map
AA seq 141 aa AA seqDB search
MRITQGTFSYLPDFTDEEITKQIEYALGNDWPLSVEFTDDPHPRNTYWEMWGLPMFDLKD
AAGVLLEVNACRQTYPNAYIRLNAYDASLGRQTTALSFIVNRPKEEPGFRLDRQEKADRR
IGYTTHSYATERPVGDRYPAE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgcataactcagggcaccttctcgtatctgcccgatttcaccgacgaggagatcacc
aagcagatcgagtatgcgttgggcaacgactggccgctgtcggtggagttcaccgacgat
ccgcatccccgcaacacgtactgggagatgtgggggttgccgatgttcgacctcaaggac
gccgccggcgtgctgctcgaggtgaacgcgtgccggcagacgtatcccaacgcctacatt
cggctgaacgcctacgacgccagcctcggccggcagacgactgcgctgtcgttcatcgtc
aaccgccccaaggaggagccggggttccggctggaccgccaggagaaggccgaccggcgg
atcggctacaccacgcactcttatgcgaccgagcgtcccgtgggggaccgctatccagcg
gagtga

DBGET integrated database retrieval system