KEGG   Mesorhizobium ciceri: Mesci_0044Help
Entry
Mesci_0044        CDS       T01401                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mci  Mesorhizobium ciceri
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesci_0044
   00650 Butanoate metabolism
    Mesci_0044
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesci_0044
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesci_0044
Enzymes [BR:mci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mesci_0044
Amino acid related enzymes [BR:mci01007]
 Aminotransferase (transaminase)
  Class III
   Mesci_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(44683..45960)
Genome map
AA seq 425 aa AA seqDB search
MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGHRHPR
VIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNGMLPGKFEKKTIFVTTGAEAVENAIKI
ARNATGRQAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHGVSVA
DSLAALDRLFKADVDPARVAAIIIEPVQGEGGFYDAPRDFLVALRKLCDQHGMLLIADEV
QTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGS
PIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAVEFND
VKKGLPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILESSIR
EVCAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattcagccatttccgaacgcaagaaccaatcgatttcccgcggcgtcggcatg
accacgcagatttatgccgaccgggctgaaaattcggaaatctgggatgtcgaggggcgt
cgctatatcgatttctcatcgggcatcgccgtcgtcaacaccgggcatcgccatcccagg
gtgatcgaggcggtcaaggcacagctcgaccgcttcacccacacctgccaccaggtggtg
ccctatgagagctatgtgcgcctggccgaacggctgaacggcatgttgcccggcaagttc
gagaagaagacgatctttgtcaccaccggggccgaggctgtcgagaacgccatcaagatc
gcccgcaatgccaccggacgtcaggcggtcatcgccttcgccggcggtttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccttacaaggtcggcttcggcgcc
atgccgggcgatgtctatcatgcgccgttccctgtgccgctgcacggtgtctcggtcgcc
gactcgctggcggcgctcgaccggttgttcaaggccgatgtggatccggcgcgcgtcgcc
gccatcatcatcgagccggttcagggcgagggcggcttctacgacgcgccgcgggatttc
ctggttgcgctgcgcaagctttgcgaccagcacggcatgctgctgatcgccgacgaagtg
cagaccggctttgcccgcaccggcaagatgtttgctatggatcaccatgaggtggccgcc
gacatcaccaccatggccaagagcctggccggcggctttcctctggcggcggtcaccggc
cgcgccgaaatcatggatgcgcccggccccggcgggctcggcggcacctatggcggcagc
ccgatcggcgttgccgcggcgcacgccgtgctcgacgtgatcgaggatgaaaagctgtgc
gatcgcgctaatacgctgggcgcaaggctgaaacagcggctgcagtcgatccgcgacgac
gtgcccgagatcgtcgacatcagaggtctcggcttcatgaacgctgtcgagttcaacgac
gtcaagaagggcctgccctcagccgagatcgccaatgcgatccggttgaaggcgctcgac
aagggcctgatcctgttgacctgcggcgtctacggcaacgtcatccgcttcctggcgccg
atcaccatccaggacgaagtcatgaacgaagcactcgacattctggaaagctcgatccgc
gaagtctgcgccgcctga

DBGET integrated database retrieval system