KEGG   Mesorhizobium ciceri: Mesci_4284Help
Entry
Mesci_4284        CDS       T01401                                 

Definition
(RefSeq) ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mci  Mesorhizobium ciceri
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_4284
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_4284
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mesci_4284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4423321..4423755
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNKVTQGQFSFLPDLTDEQISAQIKYALKNHWAVSVEYTDDPHPRNTYWEMYGNP
MFDLKDPAGILLEVNACRKACPNMYVRVTAFDSTKGWEAPRMSFIVNRPPSEPGFRLLRQ
ERDGRSQGYSIVPYATDRPEGERS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatccgggaaacaaggtcacacaggggcagttctcgttcctgcccgacctg
accgacgagcagatttcggcgcagatcaaatacgcgctgaagaaccattgggcggtcagc
gtcgagtacacggacgatccgcatccgcgaaatacctattgggaaatgtacggcaacccg
atgttcgacttgaaagatccggcgggcatactgctcgaggtcaatgcttgccggaaagcc
tgtccgaacatgtatgtgcgggtgaccgccttcgattcgaccaagggctgggaagcgccg
cgcatgtcgttcattgtcaaccggccgcccagcgaacccgggttccggctgctgcgccag
gagcgtgacggccgcagccagggttattcgatcgtgccttatgcgaccgacaggcccgag
ggcgagcggagctag

DBGET integrated database retrieval system