KEGG   Metallosphaera cuprina: Mcup_1246Help
Entry
Mcup_1246         CDS       T01467                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcn  Metallosphaera cuprina
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mcup_1246
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_1246
   00680 Methane metabolism
    Mcup_1246
Enzymes [BR:mcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mcup_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1127398..1128927
Genome map
AA seq 509 aa AA seqDB search
MRLIPRTMSTQHPDNAHLPEWVKDEVIEGDSEVLEAYYAFSNLGVHEVMWDAEGKDVDTH
VVRKLFSSFSEYFKNNVLGEDLFLTYRVPNPKIEGAERKVFAETMESIPITFDVAEKFYG
RKVVPVFEVILPFTTNAIDVISVAKYYEKAVAMEENIELYQGVYVKDLVGEIHPKRVEVI
PLIEDKDSLLNTRSILEGYYDAMKPTYMRLFIARSDPAMNYGMLTAVLLAKLALSTAYKF
SREKGIQIFPIIGVGSLPFRGHLSPENYQRVIEEYEGVYTYTVQSAFKYDYSEEQAKGAI
SHINKEEPREPKVLTDEEEKTIRDIADKYTSSYQPVIEGMADLINSIALYLPRRRARKLH
ISLFGYARSTGKVILPRAITFVGSLYSLGLPPEVIGVSVLSDLTEREWKVLEENYKFMKN
DLQKASEFINIEAINSLVSHGFLSEDLSRRIDEDIKYLESLGIKVGPRSYESKKHALLSQ
LAILSLKEKRLAEVKQYLKEMAEIRRSVG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatacccagaaccatgtcaactcaacacccagataacgcacacttaccagag
tgggttaaagatgaggtcatagagggggattcggaggttcttgaagcgtactacgccttc
tccaatcttggggtccatgaggttatgtgggacgctgagggtaaggatgtggacacccac
gtggttaggaaactgttttcctcctttagtgagtactttaaaaataacgtcttgggagag
gacctcttcttaacttatagagttccgaacccaaagatagagggagccgagaggaaggtt
tttgcggagaccatggaaagcatacctataacgtttgatgtggcggagaagttctacggt
aggaaagtcgtccccgtatttgaggttatactacctttcacaactaacgccatagatgtg
atctcggttgcaaagtattatgagaaggctgtggccatggaagagaacatagagctttat
caaggggtttacgtgaaggatctcgtaggggagatacatccgaagagggttgaagtgatt
cccctcatagaggataaggattcgttacttaacacaagaagtatcttagagggttattat
gacgcgatgaagcccacttacatgaggctgttcatagctaggtcggatcctgctatgaac
tacgggatgctaaccgctgttttgttggccaagttagcgcttagtaccgcatataagttc
tcaagagagaaagggatccagatattccccattataggagtaggatcgttgccttttagg
ggacatttgagcccagagaactatcagagagtgatagaggagtatgaaggagtttacacc
tataccgttcagtcggctttcaaatacgactactcggaggagcaagcaaagggagccata
tctcacataaataaggaggaacccagagagcccaaggtgctcactgatgaggaggagaag
acaataagggatatagccgataagtacacctccagctatcagcccgttatagagggaatg
gctgacctgataaactcaatagcgctttacttacctaggaggagagcgaggaaacttcac
ataagcctttttgggtatgcgaggagcaccggtaaggtcatccttccaagggcaataact
ttcgttgggtcgctctacagcttgggcttgccgcctgaagtcataggggtttcagtgctg
agtgatcttacagagagggagtggaaagttctggaggaaaactacaagtttatgaaaaat
gacttacagaaggcttcagagttcattaacattgaggccatcaatagcttagtctctcac
ggattcctaagcgaggatttatcaagaaggatagatgaggacattaagtacttagagtcc
ttagggataaaggtcggaccaaggagttacgagtctaaaaagcacgcactcctctcacag
ttggctatcctctcgctaaaggagaaaaggcttgcggaagtgaaacagtacttaaaggag
atggctgagataaggagatcagttgggtaa

DBGET integrated database retrieval system