KEGG   Methanobacterium curvum: MCBB_2073Help
Entry
MCBB_2073         CDS       T04503                                 

Definition
(GenBank) putative protein MJ0414
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mcub  Methanobacterium curvum
Brite
Enzymes [BR:mcub01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MCBB_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M TnsD zf-C2H2_3
Motif
Other DBs
NCBI-ProteinID: SCG86616
UniProt: A0A1D3L501
LinkDB All DBs
Position
I:complement(2147053..2148267)
Genome map
AA seq 404 aa AA seqDB search
MEINIGKQNSHKIFFFKCPSCGLSYSTALPSFIKKELPKIVDINSKKLEGAFKRGNLKYY
DSQGVEAIQFRKRIGKIESGTMICFGDKIEIIRGFPKIRRTLMLNPALKNHFADEVAVEE
KMNGYNVRIALVNNKITAFTRGGYICPYTTKKAPEIMDLTDFFTDNPEIVICGEMVGTEN
PYVTHYYPEIGSLGFRIFDLREKVSNKPLTIDEKFETLERYGLPPVKLLGIFDVEDAPEK
IMGIVKKLGEADREGVVMKDPGMKITPLKYTSSKAHADELEYAFSYPFEFGRSFFFSRVI
REGFQAYELEESWEELEERAQRLGESILYPMLDMIKHVSGGEVASEDLVIHVDSYEDAAE
FVRHLRDLGVVATLLEFDHGKAVIRRIHQSTSDRITNYLRGGLY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaatattgggaagcaaaattcccataaaatctttttttttaaatgtccatca
tgtggacttagctacagcactgccttaccctccttcataaaaaaagaactaccaaaaatc
gttgatataaactcaaaaaaattagaaggagctttcaagaggggaaacctgaagtactac
gattctcagggtgtggaagctatccagttccggaagaggattgggaaaattgaatcaggg
acgatgatctgttttggagataaaatagaaataataagaggatttccaaagataagaagg
accttgatgctcaaccctgccctgaaaaaccatttcgctgatgaggtggctgttgaagag
aagatgaacggctacaacgttagaatagctcttgtaaataataaaataactgcttttaca
cgtgggggttatatatgtccatacacaacaaaaaaagcccctgaaatcatggatttaact
gattttttcacggacaaccctgagattgtgatatgtggtgaaatggtgggaactgaaaac
ccatacgtaacccattactaccctgagattggaagcctgggattccgtatattcgacctc
agggaaaaggtttcaaacaagccccttacaatagatgagaaatttgaaacccttgaaaga
tatggactgcctcctgtgaagcttctaggtatttttgatgttgaagatgctccagaaaag
attatgggcattgttaaaaaacttggagaagcagacagggagggtgtggtcatgaaggac
cctgggatgaagataacaccccttaagtacacatcatccaaggcccatgcagatgaactg
gagtacgccttcagttatccctttgaatttggaagatccttcttcttcagcagggttata
agggaaggattccaggcctacgagttagaggaatcctgggaggaactggaggagcgagcc
cagagacttggagaatccatactctacccaatgctggacatgataaaacatgtttcaggt
ggagaagtggcttcagaggaccttgtgatccacgtggacagctacgaggatgctgcagaa
ttcgttagacacctcagggatcttggggtggttgcaaccctccttgaatttgaccatggg
aaagcagttataagaaggatacatcaatctacaagtgacaggatcacaaactatctcagg
ggtggcttatactga

DBGET integrated database retrieval system