KEGG   Microbacterium chocolatum: A8L33_09450Help
Entry
A8L33_09450       CDS       T04340                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mcw  Microbacterium chocolatum
Brite
Enzymes [BR:mcw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A8L33_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1995115..1995750
Genome map
AA seq 211 aa AA seqDB search
MAKYTLPDLPYDFAALEPHISGKIMELHHDKHHQAYVTGANTALEQLAEARESGNLANVN
KLEKDLAFNLGGHVNHSIFWTNLAPANDGGGGEPEGELRAAIDEFFGGFDRFKAHFTAAA
TGIQGSGWAVLSWDPIGEQLIIQQLFDQQSNTAQGTIPVFQLDMWEHAFYLDYLNVKADY
VSAAWNIANWQNVAQRLDAARGKTAGLLVLS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtacaccttgcccgacctcccctatgactttgcggctctggagccgcacatc
agcggcaagatcatggagctgcatcacgacaagcaccaccaggcgtacgtcaccggcgcg
aacaccgcgctggagcagcttgcggaggcccgcgagagcgggaacctcgcgaacgtgaac
aagctcgagaaggacctggcgttcaacctcggcggtcacgtcaaccactcgatcttctgg
accaacctcgcgcccgcgaacgacggcggcgggggagagcccgagggcgaactgcgcgcg
gcgatcgacgagttcttcggtgggttcgacaggttcaaggcgcacttcacggcggctgcc
accggcatccagggctcggggtgggcggtgctgagctgggacccgatcggcgagcagctg
atcatccagcagctcttcgaccagcagagcaacaccgcccagggcaccatcccggtgttc
cagctcgacatgtgggagcacgccttctacctcgattacctcaacgtcaaggcggactac
gtctccgcggcctggaacatcgcgaactggcagaacgtggcacagcgcctcgacgccgct
cgtgggaagaccgcgggcctgctggtactgtcgtaa

DBGET integrated database retrieval system