KEGG   Mycobacterium canettii CIPT 140070010: BN42_90249Help
Entry
BN42_90249        CDS       T02421                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcx  Mycobacterium canettii CIPT 140070010
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4297695..4298735)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRPVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDNVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKRGNTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcagctgaggaactcgacgtcgacggcatcgcggtgcggttgactagcccg
gacaggatgtatttcccgaagctggggtcgcacggcaccaagcgccgcctcgttgagtac
tacttcgccgtggccgggggtccgatgctgacggcgctgcgtgaccggccgacgcacttg
cagcggttcccggacggcgtcgacggcgagcagatctaccaaaagcggatcccgcggcac
cgccctgactacctgcagacgtgccgggtgacgtttccgtcggggcggatggctgacgcg
ctgaaggtgacccacccggcggcgatcgtatgggcggcgcagatgggcacaatcaccctg
cacccgtggcaggtgcgctgccccgacaccgagcaccccgacgaattgcgcatcgatcta
gatccgcaaccgggcactggcttcgtggaggcgcgtacggtcgccgtcgatgtgctccgg
cccgtgctggacgacctcggtctggtcggttatccgaagacatccgggggtagagggatt
cacgtattcctgcgcatcgccaccgactgggacttcgtcgaggtgcgtcgggcgggcatt
gcgttggcccgggaagtcgagcgccgcgcaccggatgcggtgacgacgtcgtggtggaag
gaagaacggggcgcgcgtatcttcatcgacttcaaccaaaacgcccgcgaccgcaccatg
gcgtcggcctattcggtgcgtcctaccccgatcgcgacggtatcgatgccgttgacctgg
gaagagctggccggcgcggatcccgacgactacaccatgaccacggtgcccgagctggtg
aagatccgcgacgacccctgggccggcatggacaacgtggcccagtcgatcgcaccattg
ctggacctggccgccgccgacgaggagcgcgggctcggtgacatgccgtatccgccgaac
tatccgaagatgccgggcgaacccaaacgtgttcagccgagccgggataccgacttgaag
aggggaaacacgtcgaagtaa

DBGET integrated database retrieval system