KEGG   Musca domestica (house fly): 101898313Help
Entry
101898313         CDS       T03448                                 

Definition
(RefSeq) annulin isoform X2
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
mde  Musca domestica (house fly)
Brite
Enzymes [BR:mde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101898313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 758 aa AA seqDB search
MTSWYTGYVPNWFNRFWQPNPPINPYRSIRPPHAASDAVIRVISVDLYRDENHDEHHTDH
FYAAKDALIVRRGEPFRIRLNFNRDYSPSRDAISFIFTVADDKKPNPGHGTLIGLVPRDG
IDYLGDPLEWGAGIEAHEPNSLTLLIKPAATCPVTEWKMDIDTKLLGDGSKSFTLPVPMY
VLFNPWCPDDQVYMADRDQRKEYVMHDTTLIWRGSYNRLRPSVWKLGQFERHILECSIKL
LGTVGRVPAAFRGDPVRVARALSAAVNSVDDDGVILGNWTEDFSGGIAPTKWIGSTEIIQ
QFYKTQKPVKFGQCWNFAGVLTTIARTLGIPSRIVTCYSSAHDTQASLTVDIFIDENNKK
LDAETTDSIWNYHVWNEVWMTRPDLGVGQNGLSYDGWQAVDATPQEASDNMYRVGPAPVA
AVKNGEILRPFDCGFVFSEVNADKVYWRYNGPFQPIKLLRKDTMAIGHFISTKAVLKWER
EDITSSYKYAEKTEEERNITLKALKQSQHAFSRYYLNDTFNEVEFDMQMNDDIKVGESFT
IVLCITNKSKVKAHTATGQLSCESAQYTGISNEMIKSIPFEVEIEPGATEFVRMQVVFEE
YFKKLSTQATFNISCAALVKNTDYEYYAMDDFRVRKPDIKFSFQGDIVSRQPVDVIVRLT
NPLPIPVRKGIFHIEGPGIDKPLRFKIAEIPVGGTAASTFKYTPPYAGRGTLLAKFSSKE
LDDVDGFMHYEIKPRPEDVIMNNNSNNTIIRRRTDVIP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtggtatacgggatatgtgccaaattggtttaatcgtttctggcagcctaat
ccccccataaatccgtatcgcagtataaggccaccacatgccgcctcggatgctgtcatt
agagtcattagcgttgatttgtatcgggatgaaaatcacgatgaacatcacacggatcat
ttctatgcggccaaggatgctttgattgtgcgtcgcggtgaaccttttcgaattcgcctg
aatttcaatcgtgattatagtccaagtcgtgatgccattagttttatattcaccgtggcc
gatgataagaaacccaatccggggcatggaacgctaattggtttggtgccaagggatggt
atcgattatttgggtgatcctttggagtggggtgccggtattgaggctcacgaaccaaat
agcctgacattgttaataaaacccgctgcaacatgtcctgtaacggaatggaaaatggac
attgacaccaagttgctgggcgatggctccaaatcgtttacattgcccgtgcccatgtat
gtgctatttaatccatggtgtccggatgatcaggtgtatatggccgatagagatcagcgc
aaggaatatgtaatgcatgacacaacgctgatatggcgcggttcatataatcgtctgagg
ccttcagtttggaaattgggacagtttgaaagacacatcttggaatgttccataaaattg
ctgggtactgtgggtcgagtgccagcagcgttccgtggtgacccagtgcgggttgcacgg
gccctatcggctgctgtaaattccgtcgatgatgatggtgtgattttgggtaattggacg
gaggatttctcgggcggcattgctccaaccaaatggattggttccacggagattatacag
caattctataagacccagaaaccggtgaaatttggtcaatgttggaatttcgctggggtt
ttaacaacaattgcccgtacattgggtataccttcgagaattgtaacatgctactcctcc
gcccatgatacccaggcctcgctgactgtggacattttcattgatgagaacaacaagaaa
ttggatgccgagactaccgactccatatggaattatcatgtttggaatgaggtttggatg
accagacccgatttgggggtggggcaaaatggccttagctatgatggctggcaggcggtg
gatgccactccacaggaagcctccgataatatgtatcgtgttggacctgccccagtggcg
gcggtgaaaaatggtgaaatcttgcgtcctttcgattgtggttttgtcttttccgaggta
aatgccgacaaggtgtactggcgctacaacgggccattccaaccgataaaactgttgcgc
aaagacaccatggccataggacatttcataagtaccaaggcggtcttgaaatgggaacgt
gaagatatcaccagcagctataaatacgccgagaaaaccgaagaggaacgtaacatcacg
ctgaaggcattgaaacaatcacagcatgcctttagccgttactatttgaatgatactttt
aacgaagtggaattcgatatgcaaatgaatgatgacatcaaagtgggagaatccttcaca
attgttttgtgcatcacaaataagtccaaagtgaaggcccatacagccaccggccagctg
agttgtgaatcggcccaatacaccggcatcagcaatgaaatgatcaagtctatacctttt
gaagtggagatagagccgggagccacggaatttgttcgcatgcaagttgtatttgaggaa
tatttcaagaagttgtcgacgcaggccacctttaacatatcctgcgccgccttggttaaa
aacaccgattatgagtactatgcaatggatgattttagggtacgcaagccggatattaaa
ttcagtttccaaggtgacattgtgtcacgacaacccgtggatgttattgtccgtttgaca
aatcccctacccatacctgtgagaaagggtattttccatatcgaaggaccgggcatcgat
aagccattaaggtttaagattgccgaaattcccgtgggcggtactgctgcctcaacattc
aaatacactcccccatacgcgggacgtggtacattgctggcgaaattctcctccaaggaa
ttggatgatgtcgatggttttatgcattatgaaattaaacccagacctgaagatgttatc
atgaataataattccaataatacaattattcgacgtagaaccgatgtgataccataa

DBGET integrated database retrieval system