KEGG   Malus domestica (apple): 103444237Help
Entry
103444237         CDS       T03194                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mdm  Malus domestica (apple)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103444237 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103444237 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103444237 (GAD2)
   00430 Taurine and hypotaurine metabolism
    103444237 (GAD2)
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103444237 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 501 aa AA seqDB search
MALSRTASESDVSVHSTFASRYVRTSLPRFKMAENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEAAIG
VGTVGSSEAIMLAGLAFKRKWQNKRRAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKETGWDTT
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRENMVVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDNHRHDEFEISDLLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVNDIKKVLRELDTLPSKLSSNVKAADEEGEKPGTTLESKKSDLEKTR
EITIVWRKFVMARKQKMNVVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcaaggactgcgtcggagtcggacgtctccgtccactcaaccttcgcttct
cgatacgtccgaacttctcttcctaggttcaaaatggcggaaaattcgatcccgaaggag
gcagcgtaccagattataaacgatgagctgatgttggatgggaaccctaggctgaatctg
gcttcgtttgtgacgacatggatggagcctgagtgtgataaacttatgatggcctccatc
aacaagaactacgtcgacatggatgagtaccctgtcaccactgagctccagaatcgatgc
gtaaacatgatagctcatctgttcaatgcaccattgggagattcagaggcagcaattgga
gtgggaacggtgggctcttctgaggccatcatgttggctggcttggcattcaagaggaag
tggcaaaacaagaggagagctgagggcaaacccgttgacaaacccaacattgtcaccgga
gccaatgtccaggtgtgctgggagaagtttgcaaggtactttgaggtggagttgaaggag
gtgaagttgagggatggctactatgtaatggaccctgagaaagcagtggaaatggttgat
gagaacacaatctgtgttgctgctatcctcggctccaccctcaacggtgagttcgaagat
gtcaagctcttgaacgatctcttgatagagaagaacaaggaaactggatgggatactaca
atccatgtagacgcagcaagtggtgggtttattgctccatttctatacccagaactggaa
tgggatttccgtttgccccttgttaagagcatcaatgttagcggacacaagtacggactt
gtgtatgcagggattggatgggtcatctggaggaacaaagaagatttgccggaagaactc
atcttccatatcaactatcttggagctgaccaacctactttcaccctcaacttctcaaaa
ggctccagccaagttattgctcaatattatcaactgattcgcttgggttttgagggatac
aggaacgtcatggaaaattgtcgtgaaaacatggtagtactaaaagaaggattggagaag
acaggtcgtttcaacatagtctccaaagatgaaggtgtacccttggtggccttctctttg
aaggataaccatcgccacgacgagtttgaaatctccgacttgcttcgccgcttcggatgg
atcgttccggcatacactatgcccccagacgcgcaacacatcaccgtgctacgtgttgtc
attagggaagacttctctcgcactttggccgagcggcttgtgaatgacatcaaaaaagtg
ttgagagaacttgacacgcttccatctaagcttagctccaacgtgaaggctgctgatgaa
gaaggtgagaaacctgggacgacacttgagagtaagaagagtgatttggagaaaacaagg
gagatcacgatagtttggaggaagtttgttatggccaggaagcagaagatgaatgttgtt
tgttag

DBGET integrated database retrieval system