KEGG   Malus domestica (apple): 103450387Help
Entry
103450387         CDS       T03194                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00051  Fructose and mannose metabolism
mdm00052  Galactose metabolism
mdm00500  Starch and sucrose metabolism
mdm00520  Amino sugar and nucleotide sugar metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01200  Carbon metabolism
Module
mdm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mdm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103450387
   00051 Fructose and mannose metabolism
    103450387
   00052 Galactose metabolism
    103450387
   00500 Starch and sucrose metabolism
    103450387
   00520 Amino sugar and nucleotide sugar metabolism
    103450387
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103450387
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103450387
Membrane trafficking [BR:mdm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103450387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_C
Motif
Other DBs
NCBI-GeneID: 103450387
NCBI-ProteinID: XP_008387945
LinkDB All DBs
Position
12
AA seq 492 aa AA seqDB search
MSAATTSPAVRSFYLRRRSPTVAMPRCRMAVRSAAVSLSPLLTKLHNDSATPLPLLRHVA
DSMASDMRAGLARDGGSDLKMILSYVDSLPSGNEEGLFYALDLGGTNFRVLRVQLGGKDE
RVIATEFDQVSIPPELMCGTSEELFDFIASGLAKFAQKEGNKFHLPTGTKREIGFTFSFP
VKQTSIDSGILIKWTKGFSVSGTAGRDVVACLNEAMERKGLDMRVSALVNDTVGTLAGAR
YWDDDVMVAVILGTGTNACYVERVDAIPKLQGQVSSSGRTIINTEWGAFSNGLPLTEFDR
DMDAASINPGEQIFEKTISGMYLGEIVRRVLVKMAEADALFGESVLEKLSTPFLLRTPYL
CAMQQDASDDLQAVGSILYNVAGVESSLSARKIVVDVCDTIVKRGGRLAGAGIVGILQKM
EEDSKDLIFGKRTVVAMDGGLYENYPQYRRYLQEAVAELLGTEISKNVVIEHSKDGSGIG
AALLAAANSQYI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgctaccacgtccccagccgttcgatctttctacctccggcgccgatcacct
acggtggccatgcctcgctgcaggatggccgtccgatccgctgccgtttccctatctccg
ctgttgaccaagctacacaacgacagtgccactcccctgcccctcctgcgccacgtggca
gactccatggcctccgacatgcgtgccgggctcgcccgggacggcggcagcgacctcaag
atgatactcagctacgttgattccctcccaagcgggaatgaggaggggttgttttatgca
ctggatcttggaggcacaaacttcagggtgctgagagtacaattaggcggcaaagatgag
cgcgtgattgcaaccgaattcgaccaagtttccatccccccggagctcatgtgtggcacc
tcagaggaactgtttgattttattgcttctggtttggcaaagtttgcacaaaaggagggt
aataaattccaccttccaactggtacgaaaagagaaattggattcacattttcgttccct
gtgaagcagacctccattgattccggcatactaattaagtggacaaaaggtttttccgta
tctggaacggcaggaagagatgtggttgcttgtctgaatgaggctatggaaaggaaggga
ctcgatatgcgcgtgtctgctctggttaacgatacggtaggaactttagctggagcaaga
tattgggacgatgatgtcatggttgctgtcattttgggtactggtaccaacgcttgctat
gttgaacgtgtagatgctattcccaaactacagggccaggtttcttcttccggcagaacg
attatcaacactgagtggggagcattctcaaatggtcttcctttgacggaattcgataga
gatatggatgctgctagcatcaatcccggtgagcagatctttgagaaaacaatctcggga
atgtacctcggggaaattgtaagaagagtactagtaaagatggctgaagcagatgctttg
tttggtgaatctgtcctagaaaaactatcaacaccttttctactcaggactccatatctt
tgcgctatgcagcaagatgcatctgatgaccttcaagctgttgggtcaatcctatacaat
gtagcaggggttgagtccagtttaagtgcaagaaagattgtggtggatgtatgtgacacc
atagtgaagcgaggcggacgcttagcaggtgcaggaatagtagggatactgcaaaagatg
gaggaggattcaaaagatctcatttttggcaagaggactgttgtggccatggatggaggg
ctgtacgaaaactatccacaataccggaggtatttacaagaggcggtggcagagcttcta
gggacagagatttcgaagaacgtggtgatcgagcattcgaaagacgggtctggtataggg
gccgctctcttggctgctgcaaattcccagtacatatga

DBGET integrated database retrieval system