KEGG   Monodelphis domestica (opossum): 100010059Help
Entry
100010059         CDS       T01031                                 

Definition
(RefSeq) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100010059
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100010059
   04974 Protein digestion and absorption
    100010059
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100010059
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100010059
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100010059
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100010059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 247 aa AA seqDB search
MKAIIFLALLGAAVAFPTGDDDDKIVGGYTCAANSVPYQVSLNAGYHFCGGSLINSQWVV
SAAHCYKSRIQVRLGEHNIEVLEGNEQFIDSAKVIRHPNYNSYTIDNDIMLIKLKTPATL
NSRVSSITLPTSCAATGTSCLISGWGNTLSSGSNYPDLLQCLKAPVLSDSSCRNAYPGQI
TNNMICLGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKGKPGVYTKVCNYVDWI
KTTIANN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctatcatcttccttgcccttctaggggctgctgttgctttccccaccggtgat
gatgatgacaagattgttggaggctacacttgtgcagctaactcagtcccctaccaggtg
tctctgaatgctggttaccatttctgtggtggttctctcatcaattcacagtgggtggtg
tcagctgctcattgttacaaatctcgaatccaggtgagactgggagagcacaacattgaa
gttctggaaggtaatgagcagttcattgattcagcgaaggtgatccgccatcctaattac
aattcttacaccatcgacaatgacatcatgctgattaaactgaaaacgcctgccacccta
aactccagagtgtcttccatcaccctgcccacctcctgtgctgccactggcacttcatgt
ctcatctctggctggggaaacaccttgagttctggctccaactacccagatctgcttcag
tgtctgaaagcccccgtgctttctgacagctcctgccgaaatgcctatcctggacagatc
accaacaacatgatctgcttgggctatttggagggtggaaaggattcctgccagggtgac
tctggtggccctgtggtctgcaatggagaactccaaggcattgtctcctggggttatggc
tgtgcccagaaaggaaaacctggggtctacaccaaggtctgcaactacgtggactggatt
aagacaaccattgcaaacaactaa

DBGET integrated database retrieval system