KEGG   Monodelphis domestica (opossum): 100014993Help
Entry
100014993         CDS       T01031                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04146  Peroxisome
mdo04213  Longevity regulating pathway - multiple species
mdo05014  Amyotrophic lateral sclerosis (ALS)
mdo05016  Huntington's disease
mdo05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100014993 (SOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100014993 (SOD1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100014993 (SOD1)
   05016 Huntington's disease
    100014993 (SOD1)
   05020 Prion diseases
    100014993 (SOD1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100014993 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100014993
NCBI-ProteinID: XP_001365144
Ensembl: ENSMODG00000021041
UniProt: F6VK78
LinkDB All DBs
Position
4
AA seq 154 aa AA seqDB search
MVLKAVCVLKGDGPVQGTIFFEQKQVGEPVELSGSIKGLAEGDHGFHVHEFGDNTQGCTS
AGAHFNPHSKKHGGPTDEERHVGDLGNVTANKDGVATVSIKDSHIELSGPMSIIGRTMVV
HEKADDLGKGGNAESEKTGNAGPRLACGVIGIAK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaggctgtgtgcgtcttgaagggcgacggccctgtgcaaggcactatcttc
ttcgagcagaagcaggttggagagcccgtggaactctcgggaagcatcaaaggactagcg
gaaggcgatcacggatttcacgtccatgagttcggtgacaatactcaaggttgtaccagt
gcaggtgctcactttaatcctcattccaaaaaacatggtggaccaactgatgaagagagg
catgtgggagacctcggcaatgtgacggccaacaaagacggggtggcgaccgtgtccatc
aaagacagtcacattgagctctcgggacccatgtctatcattggccgcaccatggtggtc
cacgagaaagctgatgacttgggcaaagggggaaatgcagagagtgaaaagacaggaaat
gctggacctcgcctagcttgtggcgtcattgggattgctaagtaa

DBGET integrated database retrieval system