KEGG   Monodelphis domestica (opossum): 100024319Help
Entry
100024319         CDS       T01031                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100024319
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100024319
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100024319
   00430 Taurine and hypotaurine metabolism
    100024319
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100024319
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100024319
Enzymes [BR:mdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100024319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
3
AA seq 577 aa AA seqDB search
MDFREHGFVSQPDVKPKKISCLSKNVTQYHISLRNVSTGSKGVELHGVQRRKKSICDVQG
CEEDMGKEDNIESFMTDFSNVYASDLLPSKHGGEFTEQFLLEVVDILLHYIRKTFDEKSK
ILDFHYPHQLLEGLDGFNLELSDQPEPLEQLLVDCRDTLKYGVKTGHPRFFNQLSSGLDI
IGVAGEWLTATANTNMFTYEISPVFIVMEMILLKKMHEIIGWGETEADGIFSPGGSISNL
YSILVARYKKFPEIKTKGMAVLPHIVLFVSEHSHYSIKKIAAVLGIGTDNVIEVKCDERG
KMIPLELEKNILQAKKMGLTPFCVSATAGTTVYGAFDPLDNIADICEQHNLWMHVDAAWG
GGLLMSKKHSYKLHGIERADSVTWNPHKLMGVPLQCSVVLIREMGLLKSCNQMCAEYLFQ
PDKHYDIGYDTGDKTIQCGRHVDIFKLWLMWKAKGTYGFEVQINKFMELADYLYKILKKK
ENFELVFDAEPELTNVCFWYIPPRLKSISNEYERQQELQKIAPKIKAMMIEGGTTMISYQ
PHGDKVNFFRMVFSNPATKQSDVDFLIDEIERLGKAL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggattttagagaacatggatttgttagtcagcccgatgtgaaaccaaagaaaatcagt
tgtctatccaaaaacgttactcagtaccacataagcctgagaaatgtatcaacagggtca
aaaggtgtggagctgcatggagtgcagaggagaaaaaaatctatttgtgatgtccaaggt
tgtgaagaagacatgggaaaagaagataatattgagagtttcatgactgatttttcaaat
gtttatgcctcagatttattaccatctaaacatggaggtgaattcacagaacaatttctg
ctagaagtggttgacattctcttgcattatatcagaaaaacctttgatgagaaaagtaaa
atattggatttccattaccctcatcaactccttgaaggtttggatgggttcaacttagaa
ctgtctgaccagcccgaaccactggaacagctgcttgttgattgcagagatacattaaaa
tatggagttaaaacaggacatcctcgcttttttaaccagctctctagtgggcttgatata
attggggtagctggggagtggttgacagctactgcaaatactaacatgtttacatatgaa
atatcccctgtgtttattgtcatggaaatgatactcctgaagaaaatgcatgaaataatt
ggctggggagaaacagaagctgatggaatattttctcctggtgggagcatatcaaatctc
tatagcatattggtagctcgttacaagaaatttcctgagattaaaaccaaaggcatggct
gtgcttccacatattgtattatttgtttctgaacatagtcattattccataaagaaaata
gcagcagtacttggcattggaactgataatgtaattgaggtaaaatgtgatgaaaggggg
aagatgattcctttagaattagagaaaaatatactacaagccaagaaaatgggacttact
cccttttgtgtcagtgccacagcaggtacaacagtatatggtgccttcgatcctctggac
aacattgctgatatttgtgagcagcacaacctctggatgcatgtggatgcagcatgggga
ggtggattattgatgtccaaaaaacattcttataagctccatggcattgaaagggccgac
tctgtgacctggaatccccacaaactgatgggtgtccctcttcagtgttcagttgtcctc
attcgagaaatgggtcttcttaaatcatgtaaccagatgtgcgctgagtatctattccag
cctgataaacactacgatataggctatgacactggggacaagacaattcagtgtggccgg
catgttgatatcttcaaactctggttaatgtggaaagcaaagggcacctatggctttgaa
gttcagataaataaatttatggagttggcagattatctttacaagatcctgaagaaaaaa
gaaaattttgagcttgtatttgatgcagaacctgaactcactaatgtttgtttctggtat
atcccaccaagacttaaaagcatttcaaatgaatatgaaagacaacaagaacttcaaaag
attgcaccaaagattaaggcaatgatgatagaaggtggcacaactatgatcagctaccag
ccacatggagacaaagtcaatttttttcgaatggtcttctctaaccctgctaccaaacaa
tcagatgttgattttcttattgatgaaattgaaaggcttgggaaagctctatga

DBGET integrated database retrieval system