KEGG   Monodelphis domestica (opossum): 100024802Help
Entry
100024802         CDS       T01031                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Leishmaniasis
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100024802 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100024802 (PTGS2)
   04064 NF-kappa B signaling pathway
    100024802 (PTGS2)
   04668 TNF signaling pathway
    100024802 (PTGS2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100024802 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100024802 (PTGS2)
   04913 Ovarian Steroidogenesis
    100024802 (PTGS2)
   04921 Oxytocin signaling pathway
    100024802 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    100024802 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100024802 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100024802 (PTGS2)
   05206 MicroRNAs in cancer
    100024802 (PTGS2)
   05204 Chemical carcinogenesis
    100024802 (PTGS2)
   05222 Small cell lung cancer
    100024802 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100024802 (PTGS2)
   05165 Human papillomavirus infection
    100024802 (PTGS2)
   05140 Leishmaniasis
    100024802 (PTGS2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100024802 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 608 aa AA seqDB search
MMKRISRLLLFGSIALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENCTT
PEFLTKLKLMLKPTPDTVHYILTHFKGVWNIINNIPFLRDFVMRYVLISRAHLIESPPTY
NAHYGYKSWEAFSNLSYYTRALPPVGDDCPTPLGVKGKKQLPTSKEIVEKFLLRRKFIPD
PQGTNMMFAFFAQHFTHQFFKTDHHRGPEFTKGLGHGVDLNNVYGETLDRQHKLRLFKDG
KLKYQVIDGEVYPPLVKDTEVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIYLREHN
RVCDILKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQ
FQYQNRIAAEFNTLYHWHPLLPDTFQIKDQEYNFQQFLYNNSILLKHGVSEMVESFSKQI
AGRVAGGKNVPSAVQKVSIASIDQSRQMKYQPLNEYRKRFMLKPFSSFEELTGEKEMAAE
LEAVYGDIDAMELYPALLVEKPRPGAIFGETLVELGAPFSLKGLMGNPICSPEYWKPSTF
GGNVGFEIIKTASIQSLICNNVKGCPFTAFSVQDSQPTKTATINASSSNSGLDDINPTVL
LKERSTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaggatctcacgcctcttactcttcgggtctattgcgctagcgctcagtcaa
gcggcaaacccttgctgctcaaacccatgtcaaaaccgaggcatatgtatgaccacagga
attgaccgataccaatgtgactgtaccaggacaggattttatggagaaaattgtacaact
cctgagtttctgacaaagctaaaattgatgctgaaacccactccagacacagttcactac
atcctcacccacttcaagggagtgtggaatataattaacaatatcccctttcttcgggac
ttcgtgatgagatatgtgttgatatcaagagcacatttgattgaaagtccaccaacatat
aatgctcactatggttacaaaagttgggaagctttttctaacctctcatactacactaga
gctcttcccccagtgggagatgactgcccaactccattgggtgtaaaaggtaaaaagcag
cttccaacatccaaagagattgtggaaaaatttcttctgagaaggaagtttattcctgat
ccccaaggcacaaatatgatgtttgcattcttcgctcaacatttcactcaccagttcttt
aagacagaccatcacagaggcccagaattcactaaaggtctaggacatggggttgattta
aataatgtttatggagaaacactggatagacaacataagctgcgacttttcaaggatgga
aaattgaaataccaggtaattgatggagaagtatatcctcccttagtgaaagatactgag
gtagaaatgatctacccacctcatatccctgaacatctgaaatttgctgttggacaagaa
gtatttggcttagttccaggtttgatgatgtacgctacaatatatcttcgggaacataac
cgtgtgtgtgacatccttaaacaagaacatcctgaatgggatgatgagcagttgttccaa
actagcagactgatattgataggtgagaccattaagatcgtgattgaagattatgtccaa
cacttgagtggttaccacttcaaactgaaatttgatccagaactgctgttcaaccagcaa
tttcagtaccaaaaccgaattgctgctgagtttaacaccctttaccattggcaccctctg
ctccctgacactttccaaatcaaggaccaagaatataattttcagcagttcctctataac
aactctatattactgaaacatggagtttctgaaatggtggaatcattctccaagcaaatt
gctggccgggttgctggtggcaagaacgttccatctgcagtacagaaagtttccattgct
tccattgaccagagtagacaaatgaaataccagcctctaaatgaataccgaaagcgcttc
atgctgaaaccttttagttcatttgaagaactgacaggagagaaagaaatggctgctgag
ctggaagctgtctatggtgatatcgatgctatggagttatatcctgctcttctggtggaa
aaacctcgtccgggcgccatctttggagagaccctggtagaacttggagcgcccttctcc
ctcaaaggactcatgggtaacccaatctgctcccctgagtactggaagcctagcactttt
ggtggaaatgtaggttttgaaattatcaaaacagcctctatccagtcacttatctgcaat
aatgtgaagggatgtcccttcactgcattcagtgttcaagactcccaacccaccaaaaca
gccactatcaatgccagctcatcaaactctggactagatgacatcaaccccacagtgctg
ctaaaagaacgttcaactgaactgtaa

DBGET integrated database retrieval system