KEGG   Monodelphis domestica (opossum): 100026794Help
Entry
100026794         CDS       T01031                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00240  Pyrimidine metabolism
mdo00983  Drug metabolism - other enzymes
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100026794 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100026794 (TK1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100026794 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2 zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 100026794
NCBI-ProteinID: XP_001371195
Ensembl: ENSMODG00000001854
UniProt: F6SP09
LinkDB All DBs
Position
2
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKVRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSKNFSTHDRNTMEALPACLLRDVAQNALAVTVIGIDEGQFFPDIVEFSETMANAGKTII
VAALDGTFQRKAFGNILNLVPLAESVVKLTAVCMECFREAAYTKRLGIEKEVEVIGGADK
YHSVCRLCYFKKVSGQSTGLENKENCPQSGKPGDTTSCRKLFPSQQILQCSSSN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcattaacctgcccaccgtactacccggctcccccagcaaagtccgggggcaa
atccaggtgatcctggggcctatgttctccgggaaaagcaccgagctcatgcgtagagtc
cgacgattccagatcgcccagtacaagtgcctcgtgatcaagtatgccaaagacactcgg
tacagcaaaaatttctccacacatgaccggaacactatggaagcactgccagcctgcttg
cttcgggatgtggcgcagaatgccctggctgtgactgtcattggtattgatgagggacag
tttttcccagatattgtggaattcagtgagaccatggcaaatgctgggaagacaataatt
gtagctgcactagatgggacctttcagaggaaggcatttgggaatatcctaaacttggtg
ccactggcagagagtgtggtgaaactaacagcagtgtgcatggagtgcttccgggaagct
gcttataccaagagactggggattgagaaagaggttgaggtgatcggtggtgctgacaaa
tatcactctgtgtgtcgactctgctatttcaagaaagtctcaggacaatctactgggctg
gagaacaaagagaactgcccccagagtgggaagccaggagataccacaagctgtcggaaa
ctctttcctagtcaacagattctacaatgtagttcaagcaactga

DBGET integrated database retrieval system