KEGG   Monodelphis domestica (opossum): 100033262Help
Entry
100033262         CDS       T01031                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100033262 (PCSK2)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S8: subtilisin family
   100033262 (PCSK2)
Chaperones and folding catalysts [BR:mdo03110]
 Intramolecular chaperones
  Subtilisin family
   100033262 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
1
AA seq 639 aa AA seqDB search
MLGGRVSPQWKAAVVLLCIMIFASAERPVFTNQFLVELHTGGEEEARQVAAEHGFSGVRK
LPFTGDLYHFYHNGLAKTKRRRSLPHKQQLEMDPRVKMVLQQEGFGRKKRGYRDINEIDI
NMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAA
NYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIR
MLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGG
KGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGR
KRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANRELTWRDMQHLTVLTSKR
NQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQEPEKI
PSNNKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRR
PRDDDSKVGFDKWPFMTTHTWGEDARGTWILEIGFVGSAPQKGVLKEWTLMLHGTQSAPY
IDQVVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggacgtgtttcaccccagtggaaggctgctgtggtcttgctctgtatcatg
atttttgcatctgctgagagacctgtctttactaatcagtttttggttgagttgcacacg
gggggagaggaagaagcccgtcaagttgctgcagaacacggctttagtggtgtcagaaag
ctccccttcacaggagacttgtaccacttttaccacaatggccttgccaagaccaagaga
aggcgtagtctgccccataagcagcagttggaaatggaccccagggtaaagatggttttg
cagcaggaaggatttggcagaaaaaaacgtgggtatagagacattaatgaaattgacatc
aacatgaacgatcccctgtttacaaagcagtggtacctgatcaacactggacaagctgat
ggaactccaggacttgatctgaatgtggctgaagcctgggagctggggtacacaggaaaa
ggagttaccataggaatcatggatgatgggattgactatctccatccagatcttgctgca
aactacaatgcggaagcgagctatgacttcagcagcaatgacccttatccttaccctcgc
tacacagatgactggtttaacagtcacggaacccgttgtgcaggcgaagtatcagcagca
gccaataataacatctgcggggttggagtggcttacaattccaaggttgcaggaatacgc
atgttggatcaaccatttatgacggatatcattgaagcttcctccatcagtcacatgcct
caagtgatagacatatacagtgccagttggggtccaacggataatgggaagactgtggat
ggacccagagaactcaccctacaggcaatggcagatggtgtaaacaagggccgtgggggt
aaaggcagcatctatgtgtgggcttctggagatggaggcagctatgatgactgcaactgt
gatgggtatgcctcgagcatgtggaccatctccatcaactcagccatcaatgatggccgg
actgctctgtatgatgaaagctgctcttccaccttagcatctacatttagcaatgggaga
aaaaggaatcctgaagctggtgtggcgaccacggatttatatggcaactgtaccttgcgt
cattcgggaacatctgctgctgcccctgaggctgctggagtgtttgccttggcactggag
gctaaccgggaactgacatggagggacatgcagcatctgactgtgctcacatccaaaagg
aatcaacttcacgatgaggtccatcagtggcggagaaatggggttggcctggagtttaat
catttgtttggctatggggtcctcgatgcaggagcgatggtgaaaatggctaaagactgg
aagacagtccccgagagattccactgtgtcggaggttcagtacaagagcctgagaaaata
ccatctaacaacaaattggttctaacactcacaactgatgcttgtgaaggaaaggaaaac
tttgtccgctatctcgaacatgtccaagctgtgatcacagtgaatgcaacaaggagagga
gacttgaacatcaacatgacctcccccatgggtaccaaatccattttactgagccgacgg
ccaagagatgatgactctaaggtgggttttgacaaatggcctttcatgaccactcacact
tggggggaagacgccagagggacatggatcctggaaattgggtttgttgggagtgcacca
cagaagggagtgctgaaggaatggacattgatgctgcatggaacacaaagtgccccctac
atagaccaagtagtgaaagattaccagtccaagctggcaatgtccaagaaggaagaacta
gaagaagaattagatgaagctgtggagagaagtcttaagagcattctgagtaaaaactaa

DBGET integrated database retrieval system