KEGG   Mycobacterium dioxanotrophicus: BTO20_14740Help
Entry
BTO20_14740       CDS       T05102                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mdx  Mycobacterium dioxanotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ART69681
UniProt: A0A1Y0C3C1
LinkDB All DBs
Position
3073809..3075611
Genome map
AA seq 600 aa AA seqDB search
MKGPDAVVPKHETLPAALAAAAHTDLSLFFVNAKEEDQQVSKALVHERALSIAADLMKHG
VRKGDRVALVLPTCPAFVDCFFGVLCAGGIPVPLYPPVRLGKMDEYHRRTTAMLQAVDAA
LVVTDERIRRFLGVAVQAAAPRLGCVTASDLGGADADQVDVAPDDVALIQFSSGTTHDPK
PVALTHRNLLSNLASIDSRLAEEGTATPVGVSWLPLYHDMGLIGNLLSAFYIEASLVLLP
PELFVTTPAAWLRAISRYRGTYSAAPNFAFNLCVNRIKDEELDGVDLSSWRVCFNGAESV
VAAVQRRFGERFSPWGFDPLALTPCYGMAEASLALTFKPPRTTFKTYGVEADTLAYSGRV
APGRKELVSVGRPLAGVEIEIRDDMSRPMDADKVGSIFVKGPSVMAGYFGRPDLTDQALH
EGWLETGDLGFVHDGELFVCGRAKDTVIIRGANHAPQDFEAALDGLPGVRTGCAVAVGFV
PAGEEEEALALLVETTSDAPPGLAGDVSKRVWERTGILASHVELLAPGTLPRTSSGKLRR
RESARQWQAGILTAPKKVSAMRLMWYAAKGQVSLAKATYTRLSANKRPADRAVGAGGRES
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcccggacgccgtagtcccgaagcatgaaacgctccccgccgctctcgcggcc
gcggcgcacaccgatctgagcctgttcttcgtcaacgcgaaagaagaggaccagcaggta
tccaaggcactggtccacgagcgggctctgtcgatcgccgcggacctgatgaaacacggt
gtgcggaaaggcgatcgggttgcgctcgtgctgccgacctgccccgcgttcgtcgactgc
ttcttcggggtgctgtgcgcgggcggtattcccgtgccgctgtatccgccggtgcggctg
ggcaagatggacgaataccaccgcaggaccacggcgatgctgcaggcggtcgacgcggcg
ctggtggtgaccgacgagcgcatccgccggttcctcggtgtcgcggtccaggccgcggca
cctcggctgggctgtgtgaccgcatcggatctgggaggtgctgacgccgaccaggtcgac
gtggcgcccgacgacgtcgcattgatccagttctcgtcgggcaccacacacgaccccaag
cccgtggcactgacccaccgcaacctgttgtccaacctcgcctcgatcgacagtcgtctc
gcggaggaagggaccgccaccccggtcggcgtgtcctggctgccgctgtaccacgacatg
ggtctgatcgggaatctgttgtcggcgttctatatcgaggcgtcgctcgtgctgttgcca
cccgagttgttcgtcaccacgccggccgcgtggctgcgcgccatctcacgctatcggggt
acctactcggcggctcccaatttcgcgttcaacctgtgcgtcaaccggatcaaggacgaa
gagctcgacggcgtggacctgtcgtcgtggagggtgtgcttcaacggcgcggaatccgtc
gtggccgccgtgcagcgccgcttcggtgagcgattctcgccgtggggcttcgaccctctg
gcgttgacgccgtgctacggaatggccgaggcgtcactggccctgacgttcaagcctccc
cggaccaccttcaaaacctatggcgtggaagccgataccctggcctactcgggacgcgtg
gcacccggacgcaaagagctcgtgagcgtgggccggccgctggccggggtagagatcgag
atccgtgacgacatgtcacggccgatggacgccgacaaggtcggcagcatcttcgtcaag
ggtccgagcgtgatggccgggtacttcggccggcccgatctcaccgaccaggccttgcac
gagggctggcttgagaccggagacctcggcttcgtccacgacggcgaactgttcgtgtgc
gggcgcgccaaggacacggtgatcatccggggcgccaaccacgcaccgcaggatttcgag
gccgcactggacggactgcccggggtgcgtaccggctgtgcggtggcggtcggctttgtc
ccggcgggcgaggaggaggaagcgctggctctgctggtcgaaaccacctccgacgcgcca
cccggtctggccggcgacgtctcgaagcgggtgtgggaacgcaccggcatcctggccagt
catgtcgagctgctcgcaccgggaacactgccccggacatcgagcgggaaactgcgtcgg
cgggagtctgccaggcaatggcaggccggcattctcacggcgcccaagaaagtgtccgcc
atgcggttgatgtggtacgcggccaaagggcaggtttcccttgccaaggccacctatacc
cgtctgtccgccaacaaacgaccggctgatcgcgctgtcggcgcgggtgggagggaatca
tga

DBGET integrated database retrieval system