KEGG   Methanosarcina sp. WH1: MSWH1_0007Help
Entry
MSWH1_0007        CDS       T03851                                 

Definition
(GenBank) RNA ligase, family
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mef  Methanosarcina sp. WH1
Brite
Enzymes [BR:mef01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSWH1_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AKB20278
UniProt: A0A0E3KW11
LinkDB All DBs
Position
complement(7386..8558)
Genome map
AA seq 390 aa AA seqDB search
MNKEENGEIDPNFISRLAACLGFETERIQHLFEKNYLARNWGKYDYLFRFDKEISHIERG
TVLYEKDDSFEVIMGFPKIRRAMVLDPTLKKHFSGLEKVIVEEKMNGYNVRVANVKGEVL
AITRSGYVCPYTTERAKEKLDLRFFDDFPELVLYGEMLGPDNPYVPKEIYGIESVEFYIF
DIREKNSGNPLSVARKHEILEKYSFLQVRYFGEIPLETAAEEITKIIRKLGEKEHEGVVI
KDPEMVLPSLKYTSSQSNCSDLRHAFKFYNEAGRDYMLPRIVREGFQTVEWDENEAEFKK
RYMQLGESILNPLREAIKSVKNGQRLYEEVRIRVRDLKTATEFEDYLKRLGVDAIFEAPQ
PAGDEYLINIKKVNKSTNDKTQAIWEGDLW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaggagaatggggaaatagatcccaactttataagtcgactggctgcctgc
ctgggatttgagacggagaggattcaacacctttttgaaaagaattaccttgccagaaac
tgggggaaatatgactaccttttccgcttcgacaaagagatttcccatattgaaagggga
accgtgctttacgagaaagatgattcgtttgaagtaattatgggttttcctaagatccgg
agagccatggtcctggaccctactcttaaaaagcatttcagcgggcttgaaaaggtaatt
gttgaagagaaaatgaacgggtataatgtcagggtagcaaacgtaaaaggcgaggtcctg
gcaatcacccggagtggctatgtctgcccttacacgactgaaagggcaaaagagaagctt
gacctgagattttttgacgactttcccgaactcgtactttatggagagatgctgggccct
gacaatccttatgttccaaaagaaatctatggtatcgaatccgtggagttctacatcttc
gacatccgggagaaaaatagcggcaaccctctttccgtagccagaaaacacgaaattctg
gaaaaatacagctttctgcaagttcgatatttcggagagattcccctggaaacggcagct
gaagaaattacaaaaatcatccggaaacttggggaaaaagaacatgaaggcgtggttata
aaggaccctgaaatggttcttccttcccttaagtatacttcatcccagagtaattgctcc
gacctcaggcacgccttcaagttttacaacgaagccggaagggactatatgctccccaga
attgttagagaaggatttcagacagtggaatgggacgagaatgaagccgagttcaaaaag
cgttatatgcaacttggggaaagcatcctgaaccctctaagagaggcaatcaagagtgta
aagaatggtcagaggctctatgaagaggtcaggatcagagtaagggacctgaaaaccgcg
acagaatttgaagattacctcaaaaggcttggagtggatgcgatttttgaagccccgcaa
cccgcaggagacgagtatttgataaatattaaaaaagtcaataaaagcacaaatgataaa
actcaggcgatatgggaaggagatctctggtga

DBGET integrated database retrieval system