KEGG   Methylophaga nitratireducenticrescens: Q7A_522Help
Entry
Q7A_522           CDS       T02055                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Q7A_522
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Q7A_522
Enzymes [BR:mej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Q7A_522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
528846..530264
Genome map
AA seq 472 aa AA seqDB search
MAKTYQAGVKEYRETYWMPDYTPKDTDFLACFKVIPQEGVPREEAAAAVAAESSTGTWTT
VWTDLLTDLDYYKGRAYAIEDVPGNDEAFYAFIAYPIDLFEEGSVVNVLTSLVGNVFGFK
AVRSLRLEDVRIPVAYVMTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRQRFDFVMEAIDKAEIETGERKGHYLNVTAPTPE
EMYKRAEYAKELGAPIIMHDYLTGGFTANTGLANWCRDNGMLLHIHRAMHAVLDRNPNHG
IHFRVLTKMLRLSGGDHLHSGTVVGKLEGDRAATLGWIDIMRDSYIKEDRSRGIMFDQDW
VSMPGVMPVASGGIHVWHMPALVSIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEACV
EARNHGRELEKEGKEILTAAAEHSPELKVAMETWKEIKFEFDTVDKLDVAHK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacttaccaagcgggtgtaaaagagtatcgcgaaacatactggatgcccgat
tacacccccaaagacaccgattttctggcctgtttcaaggtcattcctcaagaaggtgtg
ccacgcgaagaagcggctgctgcggtagcggcggaatcatcaacgggtacctggaccaca
gtctggaccgatttgctgactgatctggattactacaaaggtcgtgcttacgctattgag
gatgttcccggcaacgatgaagcgttctatgcctttattgcatacccgattgatttgttt
gaagaaggttcagtggttaacgtgctgacttctctggtgggtaacgtgttcggctttaaa
gccgtgcgttcattgcgtctggaagatgtgcgaattccggttgcgtacgtcatgacatgc
ggtggccctcctcatggtatccaggttgaacgtgacattatgaacaaatatggtcggcca
ttactgggctgtaccatcaaaccaaaactgggtctgtctgcaaaaaactacggtcgtgcc
gtatatgaatgtttgcgtggcggtctggatttcaccaaagacgatgaaaacgttaactca
cagccatttatgcgctggagacaacgttttgactttgttatggaagcgatcgacaaagct
gaaatcgaaacgggtgaacgtaaaggccactatctgaacgtcacagcgccaacccctgaa
gaaatgtacaaacgtgccgagtatgccaaagaactgggcgcgccaatcatcatgcatgac
tacctgaccggcggtttcacggccaatacaggtctggccaactggtgtcgtgataacggc
atgttgctgcatattcaccgggcaatgcatgcggtactggatcgcaatccgaaccatggt
atccacttccgtgtattgaccaaaatgctgcgtctgtcaggtggtgaccatctgcactca
ggcactgtggttggtaaattggaaggcgatcgtgctgcgacattgggctggatcgatatc
atgcgtgattcttacatcaaagaagatcgcagccgcggcattatgtttgatcaggattgg
gtatccatgcctggtgttatgccagtcgcttccggtggtattcacgtatggcatatgccg
gccctggtcagcatctttggtgatgattcggtattgcagtttggtggcggtacattgggt
cacccatggggtaatgcggcgggagctgcagcaaaccgtgtggctttggaagcatgtgta
gaagcacgtaaccacggcagagagttggaaaaagaaggtaaagaaatcctgaccgccgct
gctgaacatagtccagagttgaaagtggccatggaaacctggaaagaaatcaaattcgaa
ttcgacactgtcgacaaattagacgttgcacacaagtaa

DBGET integrated database retrieval system