KEGG   Methanoculleus marisnigri: Memar_1325Help
Entry
Memar_1325        CDS       T00477                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mem  Methanoculleus marisnigri
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Memar_1325
Enzymes [BR:mem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Memar_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1312736..1314028)
Genome map
AA seq 430 aa AA seqDB search
MAIDWYEEFVDLNHTPGPDELVALYYFEPAAGISKEEAVGRIASESSTGTWTTLFTLPPR
MRDLQAKAFEIEGNYVKIAYPLALWEEGNAAQLLSGIAGNVFGMKALDRLRLIDASLPAE
YLRHFKGPHFGMEGIRDMMKIRGRPLTGAVPKPKVGFTAEEHAEVGYETWMGGFDFVKDD
ENLTSQSFNRFDDRVRAMAKMRDRAEQETGDVKSAFINITADTETMEKRAKMLADYGWNY
AMIDVVVAGTAAVATLRDYCSDLGLAIHAHRAMHAAFDRDEKHGITMQFLAKMMRLVGVA
QIHTGTAVGKLVGTRAEATVLADMLREKHTNAVDHMALDQDWGNIKSAFPVSSGGLHPGL
VPDVLDIYGSELVLLVSGGIHGHPKGTRAGAEAAMQAIEAWKEGETLEEKAKKAPALSEA
LEKWGRYKPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgactggtacgaagagtttgttgatttaaaccacaccccgggcccggacgag
ctcgtagccctctactacttcgagcctgcggcggggatcagcaaggaagaggcggtcggg
aggatcgcgtcggagagttcgaccggaacctggaccacgctctttaccctgccgccccgg
atgcgggacctccaggcgaaggcgttcgagatcgaggggaattacgtgaagatcgcctac
cccctcgccctctgggaggaggggaacgcggcccagctcctgagcgggatcgccgggaac
gtcttcgggatgaaggcgctcgaccgtctcaggctgatcgacgcttcgctcccggccgaa
tacctccgccacttcaaaggcccgcacttcggtatggaggggatccgggatatgatgaag
atccgggggcggccgctcacgggagcggtgccgaagccgaaggtaggcttcacggcagag
gaacacgcagaggtcggttacgagacctggatgggcgggttcgacttcgtcaaggacgac
gagaacctgacgtcccagtcgttcaaccggttcgatgaccgcgtccgggcgatggcgaag
atgcgcgatcgggccgagcaggagaccggcgacgtgaagtccgcgttcatcaacatcacc
gccgacaccgagacgatggagaagcgggcgaagatgcttgccgattacggctggaactac
gcgatgatcgacgtcgtggttgccggaaccgctgccgtcgcgaccctccgggactactgc
tccgacctcgggcttgcgatccacgcccaccgggcgatgcacgcggccttcgaccgggac
gagaagcacgggatcacgatgcagttcctggcgaagatgatgcggctcgtcggtgttgcg
cagatccacaccgggaccgctgtgggcaaactggtcggcacccgggcggaggccacggtg
cttgcggacatgctccgggagaagcatacgaacgccgtcgaccacatggccctcgaccag
gactggggtaatatcaagtccgctttcccggtctcgtcgggcggcctccaccccgggctc
gtgccggacgtcctcgacatctacggcagcgaactcgttctcctggtcagcggcggcatc
cacggccacccgaaggggacgcgggcgggcgcagaggccgccatgcaggcgatcgaggcc
tggaaggagggggagacgcttgaggagaaggcgaagaaggctcccgcactttcggaggcg
ctcgagaagtgggggcggtataagccgaagtga

DBGET integrated database retrieval system